Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008458001
Length(AA) : 1209
Localization : scaffold_47
Number of EST contigs matching the gene: 4
Number of ESTs : 13
  User annotation : TmelmyoA5  [+]

Blast Results:

Nr Definition: myosin I MyoA/Myo5
Specie: [Aspergillus fumigatus Af293]
Accession: ref|XP_747367.1| Score: 3865 E_value: 0.0
KEGG Definition: myosin I MyoA/Myo5; K10356 myosin I
Accession: afm:AFUA_8G05660 Score: 3865 E_value: 0.0
KOG Definition: Myosin class I heavy chain
Classification: [Cytoskeleton].
Kog Number: KOG0162 Score: 3554 E_value: 0.0
PFAM Definition: Myosin_head, Myosin head (motor domain)..
Pfam Number: pfam00063 Score: 1926 E_value: 0.0
Swissprot: Q04439|MYO5_YEAST
Gene Ontology:
GO:0030479 = Cellular component: actin cortical patch
GO:0000146 = Molecular function: microfilament motor activity
GO:0005515 = Molecular function: protein binding
GO:0007121 = Biological process: bipolar cellular bud site selection
GO:0007047 = Biological process: cell wall organization and biogenesis
GO:0006887 = Biological process: exocytosis
GO:0006898 = Biological process: receptor-mediated endocytosis
GO:0009651 = Biological process: response to salt stress

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.066NO0.101NO0.045NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2520.0170.863_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.17293First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008458001
MILTAPTKRAGRKAKNKDAPTSSGGQPRVKKAVFETTKKKEVGVTDLTLI
SKISNEAINENLKKRFENREIYTYIGHVLISVNPFRDLGIYTDLVLASYR
GKNRLEVPPHVFAVAESAYYNMNGYKENQCIIISGESGAGKTEAAKRIMQ
YIAAASSTSSTTIQEIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEI
QFNSQGEPVGANITNYLLEKTRVVEQIRDERNFHIFYQFTKAASQNYRET
FGLQTPDTYLYTSKSKCLDVPGIDDVAEFQDTLSAMRVIGLSQGEQDQIF
RMLAAILWLGNIQFVEDEQGNGAISDSSVTDFVAYLLEVDGAAVHKALTL
RMIETSRGGRRGSVYEVPLNPTQATAVRDALGKAIYQNLFEWIVDRVNIS
MKTRGAIAHTIGILDIYGFEIFENNSFEQICINYVNEKLQQIFIQLTLRT
EQEEYAREQITWTPIKYFDNRIVCDLIEEKRPPGVFAALNDACATAHADS
GAADGTFVQRLNMLASNPHFENRQGQFLVKHYAGDVMYTVAGMTDKNKDQ
LLKDLLDLVGQSGNAFLRTLFPNQVDRDSKRRPPTASDKIKASANDLVTT
LMKAQPSYIRTIKPNQNKSPTEYDVPAVLHQIKYLGLQENVRIRRAGFAY
RQTFEKFIERFYLLSPKTSYAGDYTWTGDARTGTLQILKDTSIPKEEYQM
GVSKAFIKTPETLFALETMRDRYWHNMAIRIQRAWRNYLRYRAECATRIQ
RAWRKKRGGEEFLKIRDQGHKLLGGRKERRRMSLLGSRRFMGDYLGVANV
GSRLEPIRAPAGIGLGEKVLFSCRSKVLVSKLGRSSKPSPRILVMTNKAI
YIVIQAMANGQVAISSERTMPLGSIKFVSMSSLRDDWFSLGVGSPQQPDT
LVSCVFKTELVTHLRAAMPGGLDLRIGPVIEYAKKPGKMAAVKVVKDLAI
PRDDLYKSSTIHVGPGEPPNSISRPTPKGKPVAARPVTSGKLLKPGGPRG
GPARNKNPPSMTPAPNANASALLPVPPKSVVPEASRIPPPAPPAPPAAPP
RVADPTCRALYDFAGQTENELSLSKDEVVIIIRKEANGWWLTKKMNSTEQ
GWAPSAYLEEEAAPPPTPPPPPVAPARPANGAARPAGRKPAPPAPPAKRP
TVGRKPATVENRSSVAGSTSSSSSGAGSSTTSFAPGLAQALLDRQQAMRG
GRKDESDDW

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig143 hypothetical protein Bm1_17870 [Brugia malayi]2e-12
Contig1675 hypothetical protein SNOG_04683 [Phaeosphaeria nodorum SN15]1e-98
Contig2252 myosin I MyoA [Aspergillus clavatus NRRL 1]1e-163
SY0AAB31YH05FM1 hypothetical protein BC1G_10821 [Botryotinia fuckeliana B05.10]2e-91


Manual Annotation:

Please find below the necessary files for GSTUMT00008458001 annotation :

link to GSTUMT00008458001 Artemis file
link to scaffold_47 sequence file
link to scaffold_47ESTs