Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008448001
Length(AA) : 583
Localization : scaffold_47
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : TmelSCW11  [+]

Blast Results:

Nr Definition: hypothetical protein SS1G_04264
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001594457.1| Score: 775 E_value: 4e-80
KEGG Definition: cell wall glucanase (Scw11), putative [EC:3.2.1.-]; K01238
Accession: afm:AFUA_8G05610 Score: 729 E_value: 4e-75
KOG Definition: Circadian clock protein period
Classification: [Signal transduction mechanisms].
Kog Number: KOG3753 Score: 131 E_value: 4e-08
PFAM Definition: Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo..
Pfam Number: pfam05109 Score: 200 E_value: 4e-16
Swissprot: P53189|SCW11_YEAST
Gene Ontology:
GO:0009277 = Cellular component: fungal-type cell wall
GO:0005515 = Molecular function: protein binding
GO:0007109 = Biological process: cytokinesis
completion of separation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.714YES0.942YES0.677YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.7220.5230.007M528

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.64077First60=0.58514PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008448001
MRYSLFAVAATALLSGSAAARGHQHRRHAHPHALAPRGECEVSPPQCKTY
TSSILVPVGTVPPSDASTVKQTMTVVPVVEPTTTIKTTVTYTSTSTNVVT
VTKPKSASVPSASSAPVVPTPIVTVCPTPGTYTIPAQTVVLTSTETVCVP
ETTSLPPGTHTIGGVTTVVHTATTVVCPVAAVETASGVTTSKVVLTTYVC
PTAGTYTIGASTTTVTGTVTVPCTYPVPTAYPPGTYTHPEVVTTVTVTSA
VVVCPYTTKGLPTSAPGAHTTTPLPPASTVSATSVASSVAPTTTPLAPSS
TASATPVSSSSAPSSSATSKPVSGGGLWAITYSPYTANGGCKTASEVSAD
ITSIASKGFQNIRLYSTDCDGLKNVGSACEANGVGIILGVFIKAGGVSTA
DEQVKDILEWKKFELVVLFVVGNEAVFNGFCTAEELAAYISKVKGQLQGA
GYTGHVTTAETLNILQAHGSVLCSAMDVVGVNAHAFFNPQNTAEKAGEFV
KGQLKLASDACGGKPGWVLEAGWPSAGQPNGNAVPGAAEQKAAIASMVKE
CPGQITYFSFENDLWKTAGAFGVEPNFGCLGVF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1899 No hit found
Contig2603 hypothetical protein SS1G_04264 [Sclerotinia sclerotiorum 1980]4e-30


Manual Annotation:

Please find below the necessary files for GSTUMT00008448001 annotation :

link to GSTUMT00008448001 Artemis file
link to scaffold_47 sequence file
link to scaffold_47ESTs