Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008427001
Length(AA) : 608
Localization : scaffold_47
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : TmelMLH1_like  [+]

Blast Results:

Nr Definition: DNA mismatch repair protein, putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001262126.1| Score: 683 E_value: 2e-69
KEGG Definition: DNA mismatch repair protein, putative
Accession: afm:AFUA_8G05820 Score: 674 E_value: 9e-69
KOG Definition: DNA mismatch repair protein - MLH1 family
Classification: [Replication
Kog Number: KOG1979 Score: 448 E_value: 7e-45
PFAM Definition: DNA_mis_repair, DNA mismatch repair protein, C-terminal domain. This family represents the C-terminal domain of the mutL/hexB/PMS1 family. This domain has a ribosomal S5 domain 2-like fold..
Pfam Number: pfam01119 Score: 130 E_value: 5e-08
Swissprot: P54277|PMS1_HUMAN
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0003677 = Molecular function: DNA binding
GO:0006298 = Biological process: mismatch repair

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.147NO0.386NO0.133NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1240.1310.805_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.04511First60=0.00012PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008427001
MGIQALPDTAVRALGSGQVLTDPVSLIKELLDNSLDALATAISIEVSQNT
LDVLQVKDNGHGIPTEDREFVAMRHCTSKITDFEEIQDCRSLGFRGEALA
SAAELAGGLVITTMVEGEKVAMACTCDRVGKVTARKPVGAMKGTTVRVTD
FFKFLPVRRENAIKGAQKSLSKVRTLLQRYYLSHPACRFSLRVLAPPQKS
KAAGGQSEDIVYAPSKSVSEAVMKAVGKEIVATCQWINTEHEEVTDGSGE
QKIGIEAFMPKPGSDPAIICRKPQCTNFVFVDSRPVSCARGTLKQILSLY
KSYLKSALPDSAISDPFLYLNLRCPPGAYDPNIEPAKDDVMFFHADRVIG
AVEVIFKGLYGELKTKSSPGGSGGKGKSVEMMTGGFELLLARKRDPKPGT
TKPPEAPEIDEDEEEMAAQQVNMMMELDEDPPAAGLTPANPGKAPPVQTR
EESPHRSHNRDGSVRPPMFSITDAPSPGSVRPGELNQEPTPPAAPLAQMV
QTPRRRPTNWGFNMSSGYDEDESDLVLDEVERQVRSDLAEEQADEAAARD
IAISNPWTAAKMNSPASGSNQPFSPAIVPSIWSSTVSSLLCDSCIVLATD
DHNAPNSK

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB56YJ04FM1 hypothetical protein SS1G_04226 [Sclerotinia sclerotiorum 1980]2e-15


Manual Annotation:

Please find below the necessary files for GSTUMT00008427001 annotation :

link to GSTUMT00008427001 Artemis file
link to scaffold_47 sequence file
link to scaffold_47ESTs