Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008328001
Length(AA) : 669
Localization : scaffold_45
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001261641.1| Score: 419 E_value: 8e-39
KEGG Definition: hypothetical protein
Accession: ani:AN8923.2 Score: 409 E_value: 6e-38
KOG Definition: No Hit Found
PFAM Definition: Tymo_45kd_70kd, Tymovirus 45/70Kd protein. Tymoviruses are single stranded RNA viruses. This family includes a protein of unknown function that has been named based on its molecular weight. Tymoviruses such as the ononis yellow mosaic tymovirus encode only three proteins. Of these two are overlapping this protein overlaps a larger ORF that is thought to be the polymerase..
Pfam Number: pfam03251 Score: 125 E_value: 2e-07
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.610YES0.872YES0.498YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0480.930.136S217

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.97104First60=0.01856PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008328001
MLPKYLWMWVAAECVPGWVIDSEHLPRVQECLSVVNSTANRLAKLSVGAV
SEEAWNAGFGYPPGHAVLLSVILLGELLDNALAGVVFSLPKMKMLSWEYS
LFGKYLLQKAGWCLGELDMLGITEPAILFYVGSFDRVALKKDHSRCSDRV
CLANQIDERVYQTKHVMETCTCEHIIVEEEGNRPVTEVLHKGDIPTISFD
GEKVFVHSSDSAPYVAMSHVWSDGLGNPHTNSLPKCQLERIQGLVNALHP
DRDPASPVPFWLDTVCVPLHAETRKTAIRRMAKTYDSAAKVLVLDVSLSG
TSAGVPADELLMRIRCTPWTQRLWTLQEGMLAEELYFQFRDKAIAAESLP
DNWYYENSPVKLCGKHFGRPRADNLPLETRVFRALASDADEFVKDEMAME
SALETLSRHPDCPDILDHTLLYRLDTNHSASFHPVYFAGWTSFQKLRYRF
GVGHSALPSVAGALRGRLSSKMDDETICVATLLDIDPLHILSAKSQIARM
KVLIDSVDNFPPSLIFTNVPRMDLDGYRWAPESFMDKNANYAGLLRAGET
GRRTEDGLLVSNYFSYAFPKDWTFPDAGSFVVKGWESYFRITHAHALTVE
VARPAVILEQPPATVSRGIVVDMWREDDGVVKFGRHVGHVSIEALGGEWA
GEVVCEVVKWPISYKWCVG

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB11YK19FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00008328001 annotation :

link to GSTUMT00008328001 Artemis file
link to scaffold_45 sequence file
link to scaffold_45ESTs