Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008321001
Length(AA) : 343
Localization : scaffold_45
Number of EST contigs matching the gene: 1
Number of ESTs : 11
  User annotation : No user annotation

Blast Results:

Nr Definition: ketol-acid reductoisomerase
Specie: [Caldivirga maquilingensis IC-167]
Accession: ref|YP_001540985.1| Score: 416 E_value: 7e-39
KEGG Definition: ketol-acid reductoisomerase [EC:1.1.1.86]; K00053 ketol-acid reductoisomerase
Accession: cma:Cmaq_1168 Score: 416 E_value: 4e-39
KOG Definition: No Hit Found
PFAM Definition: IlvN, Acetohydroxy acid isomeroreductase, catalytic domain. Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates. This reaction is the second in the synthetic pathway of the essential branched side chain amino acids valine and isoleucine..
Pfam Number: pfam07991 Score: 427 E_value: 1e-42
Swissprot: Q971A9|ILVC_SULTO
Gene Ontology:
GO:0004455 = Molecular function: ketol-acid reductoisomerase activity
GO:0009097 = Biological process: isoleucine biosynthetic process
GO:0009099 = Biological process: valine biosynthetic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.066NO0.243NO0.087NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5620.0370.479M532

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.60241First60=0.00501PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008321001
MAKIYRPNDASLSPLSSKTILFAGYGNQSRSQALNLRDTFASNPDVSAPK
ILIANRTDSYHETAIADGFSVTSFAEGAKEADVVFLLVPDQVAPALYNSE
IGPNLRTGALVVVASGFNVFYKRLEVEGVDVGMVAPRMIGAGVRSRFLEG
GGFPCFVSVENNFSGRALEMILSLALGIGGLTAGAVECSARDETLMDLFA
EQAVWPSIIVAFREAYSTLKKLGCSDEALVHELWLSKEPAEVFEKCAEDG
FIAQLKYHSTVSQYGQLSTSLGMDATKLQEFFKNVAEKRILGGEFTKEFI
DIDKEGGGNGMERKLGGLYAAASTSELAVGEKKVRERMGLDKV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4465 ketol-acid reductoisomerase [Caldivirga maquilingensis IC-167]6e-32


Manual Annotation:

Please find below the necessary files for GSTUMT00008321001 annotation :

link to GSTUMT00008321001 Artemis file
link to scaffold_45 sequence file
link to scaffold_45ESTs