Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008285001
Length(AA) : 402
Localization : scaffold_44
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: histidinol-phosphate aminotransferase
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP56646.1| Score: 1247 E_value: 1e-135
KEGG Definition: histidinol-phosphate aminotransferase [EC:2.6.1.9]; K00817 histidinol-phosphate aminotransferase
Accession: afm:AFUA_1G14090 Score: 1247 E_value: 1e-135
KOG Definition: Histidinol phosphate aminotransferase
Classification: [Amino acid transport and metabolism].
Kog Number: KOG0633 Score: 1025 E_value: 1e-112
PFAM Definition: Aminotran_1_2, Aminotransferase class I and II..
Pfam Number: pfam00155 Score: 502 E_value: 2e-51
Swissprot: P36605|HIS8_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0004400 = Molecular function: histidinol-phosphate transaminase activity
GO:0000105 = Biological process: histidine biosynthetic process
GO:0010045 = Biological process: response to nickel ion

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.153NO0.430NO0.112NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.40.0590.594_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.0581First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008285001
MAPTSAFNLQTCARKNILQLVPYRCARDDYKDDGSNILLDANENAYGPSL
PFNCPDESEAGIGYDYTHLNRYPDPHQEDLKRLFCNYRNKNPTKPLTPAN
LFLGVGSDEAIDAVLRCFCIPGRDKILTCPPTYGMYSVSAQVNDVEVIRE
PLDLVSGEFELRPDAINKRLSEDPTIKLVYICSPGNPTAGTVDPEAVRKV
LAHPTWNGVIVVDEAYIDFAPEGSSLAPCVVDHPNLVVMQTLSKAFGLAG
IRLGAAFTAPEIARLLNNLKAPYSVSSTTSSLAMAALSPAGLAVKNENVR
RLLVQRDRIISELPELPGIGRFLGGFDSNFLLVEILDNNAVPNSGVAKKV
YEQLAEEHGVIVRYRGGEAGCTGCLRITVGTEAEVGRLLKKLRETLNAVR
GE

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAD56YM22FM1 histidinol-phosphate aminotransferase [Ajellomyces capsulatus NAm1]2e-52
SY0AAD62YD04FM1 histidinol-phosphate aminotransferase [Aspergillus terreus NIH2624]6e-69


Manual Annotation:

Please find below the necessary files for GSTUMT00008285001 annotation :

link to GSTUMT00008285001 Artemis file
link to scaffold_44 sequence file
link to scaffold_44ESTs