Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008250001
Length(AA) : 1542
Localization : scaffold_43
Number of EST contigs matching the gene: 3
Number of ESTs : 22
  User annotation : No user annotation

Blast Results:

Nr Definition: RNA-directed RNA polymerase (Sad-1), putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001263772.1| Score: 2390 E_value: 0.0
KEGG Definition: RNA-directed RNA polymerase (Sad-1), putative [EC:2.7.7.48]; K00985 RNA-directed RNA polymerase
Accession: afm:AFUA_3G06790 Score: 2360 E_value: 0.0
KOG Definition: RNA-directed RNA polymerase QDE-1 required for posttranscriptional gene silencing and RNA interference
Classification: [RNA processing and modification].
Kog Number: KOG0988 Score: 1386 E_value: 1e-153
PFAM Definition: RdRP, RNA dependent RNA polymerase. This family of proteins are eukaryotic RNA dependent RNA polymerases. These proteins are involved in post transcriptional gene silencing where they are thought to amplify dsRNA templates..
Pfam Number: pfam05183 Score: 980 E_value: 1e-106
Swissprot: O14227|RDR1_SCHPO
Gene Ontology:
GO:0005721 = Cellular component: centric heterochromatin
GO:0005829 = Cellular component: cytosol
GO:0031934 = Cellular component: mating-type region heterochromatin
GO:0031380 = Cellular component: nuclear RNA-directed RNA polymerase complex
GO:0005724 = Cellular component: nuclear telomeric heterochromatin
GO:0003968 = Molecular function: RNA-directed RNA polymerase activity
GO:0030702 = Biological process: chromatin silencing at centromere
GO:0007059 = Biological process: chromosome segregation
GO:0008104 = Biological process: protein localization
GO:0031060 = Biological process: regulation of histone methylation
GO:0016246 = Biological process: RNA interference
GO:0031048 = Biological process: chromatin silencing by small RNA
GO:0045141 = Biological process: telomere clustering

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.103NO0.232NO0.073NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6870.0310.377M4116

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.04963First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008250001
MAPPAAAMSHHRAENAQPVSSSGSTLNPRANPYLAVSSISQLALLTQQEV
QQAATASGNGDRPVQSTLTNGASRPASIRTAPLRGNPISSRRGYPGPLGR
GSPTRSRNNDEFHRRSYNDRALPMLTSLPSRSEILAPRPTTRNTGDRGDV
GRGYHNGRENNRPSHSNSHPTPYTDPTNHSLSENTVSMASATNIQNGNNT
HSSRGLPILMQNDWKKTDEISIEISGIPLPLDLYNLYDIFSEYGEIEYLK
LYHNDSGVPDGNGRISLSNVERPFWEEPFRYSLGVQGPNGSLKLRLDSRR
NKQRTVQSPVDRQKSYPQKYSFKLALLQFGILHQEDKMVPMFTTTGQDEA
SLDVDLHRRELDIVFKIWLKNDASAQTNQSQEEVEGDVNNYDDDDSNAPE
NKPTERFERYRFGVPFSHLEKLVEVETLSAPGRAFLIDLPSAPPFWRKLH
NPRLSIDDRIKYWTSRNAWFRQTSITFDNSARKGLPISLEQRGQTINIGR
WTTYRFEVGTKEAGSDGFNEMISALKDFNIKLDVQKDFKTLSEKFDPIWD
YIRIKRIQSSVSFLDQLHQASSPLLSYPVRYQLEVCISHNCLSEYNITCE
FIDRLAALPKEAAIPLLEHIAERRIRHYDPMDIFTIQGVTKGTINLKLPD
HCQLLRKANVTPSTVYFTTPTVEITNRVVRQYSEHIDRFLRVQFVDEKSQ
GRINSTDKKTMHEVFTRVKAALDHGITIGDRKFEFLAFGNSQIREHGAYF
FASDDHLSAADIRAWMGSFSEIRIVAKHAARLGQCFSTTRAINGVRVDVR
TTEDIVNAEGYNFSDGVGKISEFLARLITTELRLRLVDKEPVPSCFQFRL
GGRKGVLAVSPDANHREVYIRPSQLKFEARHNILEVIRWSKFATAALNRQ
LIIVLTSLGAPDHYFEDKLQFMLKSYEVAMVDPGVAVRLLCRNVDPNEST
LAIAAMIRAGFMDRREPFVMSLLKLWRAWTIKYLKEKAKIMIEEGAFVLG
VVDETGTLDGYYYSQDEGSTEDADNPETSLPQIFLQVTDPDRPGESRIIE
GPCVIARNPSLHPGDVRKVMAVNAKELHHLRNVVVFSQKGDRDLPNMLSG
GDLDGDDYIIIWDKKLTSCVNNYEPMNYSAQTPRELARDVEIGDITKFFV
NYMKNDKLGTIANAHLAWADKRDEGVKSDECFRLAILHSHAVDYVKSGEP
AIMPPELRRKTFPHFMEKKPEETYRSDKILGVLYDSVSKIDFVPALELEF
DDRILNAYTLNEEILEVARAIKIRYDAAMRRIMAQHDIHTEFEVISIFIM
HHSMATKDYKFHEDIASVCNGLKDTFKKIIYEVVASKDDIIMGPFIAAMY
FVTHQEMAKAKKKFFAAKAKKAAMRAAKRASGNEKAQREGNIPSCTKDLE
ELAEFTIEEARNMPLISFPWLFGRTLGGIANREYPFAKLDGSPVNFKQAA
AVTDELEGRMGKKEKYATYHHGIYDDAVAATTPIIRGNETDTPDNLWNGE
SSLGISQRGTNPEDVTTTTTDKIIPTSPDSNTGYDGGEANLI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig212 hypothetical protein SS1G_13161 [Sclerotinia sclerotiorum 1980]1e-109
Contig3708 RNA-directed RNA polymerase (Sad-1), putative [Neosartorya fischeri NRRL 181]1e-133
Contig5206 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00008250001 annotation :

link to GSTUMT00008250001 Artemis file
link to scaffold_43 sequence file
link to scaffold_43ESTs