Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008238001
Length(AA) : 334
Localization : scaffold_43
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: PREDICTED: similar to Chain A, Structure Of Wdr5
Specie: [Ornithorhynchus anatinus]
Accession: ref|XP_001506016.1| Score: 1021 E_value: 1e-109
KEGG Definition: WDR5; WD repeat domain 5
Accession: gga:417144 Score: 1021 E_value: 1e-109
KOG Definition: WD40 repeat-containing protein
Classification: [General function prediction only].
Kog Number: KOG0266 Score: 756 E_value: 6e-81
PFAM Definition: WD40, WD domain, G-beta repeat..
Pfam Number: pfam00400 Score: 134 E_value: 9e-09
Swissprot: Q498M4|WDR5_RAT

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.018NO0.033NO0.018NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1190.0590.896_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.48917First60=0.00034PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008238001
MSTQEPSSSVQPEQADIKMTDPSNARTVPNYALTYTLKGHKMGVSSVKFS
PDGAWLASCSADQTIKVWHAKTGKYEQTLEGHMAGISDIDWAPDSLTLVS
GSDDKTLRLWDVVSGKMLRLLRGHHNAVYTVAFSPRGNIVASGSYDEAVR
LWDIRSGKCMKTLPAHGDPVSGVHFNRDGTMIVSCSHDGLIRIWDVTTGQ
CLRTLVEEDNAPVMAVKFSPNGKYLLAGTQDSCVRLWDYHRGKCLKTYMG
HKNDKYSIFSTFIIANGSCFVMAGSENSDVFIWDIQTKEIVHLLVGHPDV
VLGVDSHPTENIVASCGLDGTVMVWMDSAEGLDE

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA59YB18FM1 will die slowly [Culex pipiens quinquefasciatus]7e-53


Manual Annotation:

Please find below the necessary files for GSTUMT00008238001 annotation :

link to GSTUMT00008238001 Artemis file
link to scaffold_43 sequence file
link to scaffold_43ESTs