Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008233001
Length(AA) : 435
Localization : scaffold_43
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_09359
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001589637.1| Score: 295 E_value: 1e-24
KEGG Definition: hypothetical protein
Accession: ani:AN4832.2 Score: 207 E_value: 9e-15
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: A7KAN7|ATG29_PENCH
Gene Ontology:
GO:0000407 = Cellular component: pre-autophagosomal structure

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.099NO0.156NO0.081NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4430.030.617_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00055First60=0.00024PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008233001
MPNVLGLGSRQSSARGATGAGGGGGGPGEVPGAGSGPSRTGTPLSQRTNS
LRGEREGSRRGQTPPMPQQPEEKYIVYLRFPFARNGFVDPPQVDWDAGKE
SASHLQVSRAFLLQQAAWLYERELSQIQAQMRRAGGPILNTNLSFPTPAS
PRPQSPAVMGGVPMARTGTAGTADLRAHSSLSVRSNPITTPNPRTTPLPP
TPTTSTRPVAQPMSRTCSARTATQVTTAHRLSSHVPAEPVRNPSPAQRLS
SSEVSEEEIESSTTGSSDDDDDDDDTDQPPRRLQGFLQKNRGTSSDEDEG
DNEPAFLPFPSAEKPLSLGEANMTGTVILPRRGAAGAISGKGKEVNRSVT
SPALEAALKKQVPAAMSSPRKLTVTDSAGPSSPSMGSSFSDLSDTSVTQS
AMEDAYLSTMQAGGMGSRMSSLSQAVRSRYFPTSN

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1520 hypothetical protein SS1G_09359 [Sclerotinia sclerotiorum 1980]8e-26
SY0AAC36YE19FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00008233001 annotation :

link to GSTUMT00008233001 Artemis file
link to scaffold_43 sequence file
link to scaffold_43ESTs