Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008154001
Length(AA) : 156
Localization : scaffold_42
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: PMP20
Specie: [Schizosaccharomyces pombe]
Accession: emb|CAA05528.1| Score: 450 E_value: 2e-43
KEGG Definition: pmp20; hypothetical protein [EC:1.11.1.15]; K03386 peroxiredoxin (alkyl hydroperoxide reductase subunit C)
Accession: spo:SPCC330.06c Score: 450 E_value: 8e-44
KOG Definition: Alkyl hydroperoxide reductase/peroxiredoxin
Classification: [Posttranslational modification
Kog Number: KOG0541 Score: 425 E_value: 4e-43
PFAM Definition: Redoxin, Redoxin. This family of redoxins includes peroxiredoxin, thioredoxin and glutaredoxin proteins..
Pfam Number: pfam08534 Score: 285 E_value: 8e-27
Swissprot: O14313|PMP20_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0006950 = Biological process: response to stress

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.251NO0.777NO0.166NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0660.270.795_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.27114First60=0.0446PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008154001
MISVGSSIPAAPASLWVEKDNNTVSLPSSGKYIIVGVPGAFTPPCSSHVP
GYVENYDKLQAKGISAVYVVAVNDIFVVNAWKEQLAKGSSVHFLSDSKGE
FTRLVGLDFDASGLLGNARSQRYVAVVEDGKVTNLQVENEAPNITVTHVD
KILSSL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1255 PMP20 [Schizosaccharomyces pombe]3e-43
SY0AAC13YC03FM1 PMP20 [Schizosaccharomyces pombe]4e-43


Manual Annotation:

Please find below the necessary files for GSTUMT00008154001 annotation :

link to GSTUMT00008154001 Artemis file
link to scaffold_42 sequence file
link to scaffold_42ESTs