Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008074001
Length(AA) : 429
Localization : scaffold_41
Number of EST contigs matching the gene: 4
Number of ESTs : 61
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001209556.1| Score: 948 E_value: 1e-100
KEGG Definition: vacuolar H+/Ca2+ exchanger; K07300 Ca2+:H+ antiporter
Accession: afm:AFUA_2G07630 Score: 926 E_value: 4e-98
KOG Definition: Ca2+/H+ antiporter VCX1 and related proteins
Classification: [Inorganic ion transport and metabolism].
Kog Number: KOG1397 Score: 708 E_value: 3e-75
PFAM Definition: Na_Ca_ex, Sodium/calcium exchanger protein. This is a family of sodium/calcium exchanger integral membrane proteins. This family covers the integral membrane regions of the proteins. Sodium/calcium exchangers regulate intracellular Ca2+ concentrations in many cells; cardiac myocytes, epithelial cells, neurons retinal rod photoreceptors and smooth muscle cells. Ca2+ is moved into or out of the cytosol depending on Na+ concentration. In humans and rats there are 3 isoforms; NCX1 NCX2 and NCX3..
Pfam Number: pfam01699 Score: 181 E_value: 4e-14
Swissprot: Q99385|VCX1_YEAST
Gene Ontology:
GO:0000324 = Cellular component: vacuole
cell cycle-correlated morphology
GO:0015085 = Molecular function: calcium ion transmembrane transporter activity
GO:0006816 = Biological process: calcium ion transport
GO:0006874 = Biological process: cellular calcium ion homeostasis

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.042NO0.290NO0.044NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0470.0860.951_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=205.963First60=11.3566PredHel=9
Topology=(50-72,76-97,109-131,141-163,219-238,267-289,337-359,369-386,393-415)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008074001
MEMQQPLNGGRDHGKIERDVTSPIPDPEMTRPGRRGCNPFRAFVIMLRSS
SSLGACTNVLLPFVPVGLLLHWWKPDLHLWIFLTNYLAMIPMANLLAFSS
AQFSRRLPRVLGVIIQLTFASSVEVILCLVLLFKSQFQVIQAALLGSMLA
NLLLCTGLCFIVGGIRTKAQEFSETVVETGGGLLLVSVASLMLPCAFFES
VSAMGRLPQDELDHKVLHISRFSAVLLLIAYVTYLFFQLATHHSEFDQAL
YESEQRNKDRADNIRRENLTIGEAAFLTFMSLAFVTLHAVFLVEQIHWIV
SHKHVSDAFMGLILVPLVEKAAEHLKGIDEAWDDAMDFALSHLLGSTIQT
ALLVSPIIVLVGWAAHKPFNLNFEVFMVIALVFSVLIVGNFIKDRKSNYL
EGALCVIFYIMIAVTTWYYPSPEGMEEEH

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1495 conserved hypothetical protein [Aspergillus terreus NIH2624]2e-35
Contig2584 conserved hypothetical protein [Aspergillus terreus NIH2624]1e-99
Contig3243 conserved hypothetical protein [Aspergillus terreus NIH2624]9e-18
SY0AAA63YN14FM1 vacuolar H+/Ca2+ exchanger [Neosartorya fischeri NRRL 181]5e-33


Manual Annotation:

Please find below the necessary files for GSTUMT00008074001 annotation :

link to GSTUMT00008074001 Artemis file
link to scaffold_41 sequence file
link to scaffold_41ESTs