Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00008061001
Length(AA) : 545
Localization : scaffold_41
Number of EST contigs matching the gene: 2
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein AN7475.2
Specie: [Aspergillus nidulans FGSC A4]
Accession: ref|XP_680744.1| Score: 324 E_value: 6e-28
KEGG Definition: hypothetical protein
Accession: ani:AN7475.2 Score: 324 E_value: 3e-28
KOG Definition: DNA-binding protein YL1 and related proteins
Classification: [General function prediction only].
Kog Number: KOG2897 Score: 246 E_value: 2e-21
PFAM Definition: YL1, YL1 nuclear protein. The proteins in this family are designated YL1. These proteins have been shown to be DNA-binding and may be a transcription factor..
Pfam Number: pfam05764 Score: 342 E_value: 1e-32
Swissprot: Q5E9F6|VPS72_BOVIN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.039NO0.094NO0.049NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5680.0570.401M5107

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00008061001
MGNSVVESLVAGRERRSTAGNRLASLLHQEADTEDTLFLEDEDDVEFEAR
DVEELSDVLLESSDDEDEYNGGGGVDGKEGGQGEEDLEGERELQQQAKEE
RAAKKRKAAEAFLKPRVSTRKRVTIQDGSSTTTTATAAQTTATSPSRGSP
PRPRKKSERVSWIPEFTATRASSRTLSLQNRTETMKRLQESEKRRLHTIK
LMEAAAAKKDKENPRKEMTQVERLKEAKLTEERNLKSLNKWEESEAVRLE
EQRKKLAALQNRKLVGPVITWWSGTAEWNGEGKLVRVGKGLVEILDNSED
GEKGGGKKAKGRKSKGAKAAAVKSKDKEKSITDGNGDDSKEAVQLPQLHQ
TIDGRRENASNSNIESPQLPPSGPTQSDEAANAKSNAILTSDNIINASSN
TPSNANPQPSSSTQEVLHRDHGPIPILLEGILDYAALPEPSPGREKDPPD
MQRGEISPCTSPHVTSETAKPKTEHSSRNLVVLENFDPVAVQTREGLVKV
LFPSDPKRTWQRFKKYSGEKSNGVVYWEHTSVHPMSPRKECRTDF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1781 hypothetical protein AN7475.2 [Aspergillus nidulans FGSC A4]9e-06
SY0AAB48YO09FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00008061001 annotation :

link to GSTUMT00008061001 Artemis file
link to scaffold_41 sequence file
link to scaffold_41ESTs