Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007997001
Length(AA) : 959
Localization : scaffold_41
Number of EST contigs matching the gene: 4
Number of ESTs : 16
  User annotation : TmelAARS  [+]

Blast Results:

Nr Definition: alanyl-tRNA synthetase, cytoplasmic
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001248510.1| Score: 3235 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An16g09320 Score: 3136 E_value: 0.0
KOG Definition: Alanyl-tRNA synthetase
Classification: [Translation
Kog Number: KOG0188 Score: 2916 E_value: 0.0
PFAM Definition: tRNA-synt_2c, tRNA synthetases class II (A). Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only alanyl-tRNA synthetases..
Pfam Number: pfam01411 Score: 1876 E_value: 0.0
Swissprot: O13914|SYAC_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.253NO0.547NO0.159NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1970.0840.732_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00823First60=0.0076PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007997001
MASPLSTVEWPASLVRKTFIDYFKNNGHTFVPSSSVVPLSDPTLLFANAG
MNQYKSIFLGTVDPSSDFASLKRAANSQKCIRAGGKHNDLDDVGKDSYHH
TFFEMLGNWSFGDYFKKEAVEYSWELLTEIYGLDPDRLYVTYFEGNKERG
LEPDLETQELWRAVGVADNHILPGNMKDNFWEMGDQGPCGPCSEVHYDHI
GGRNASHLVNMDDPNVIEIWNNVFIQYNREPDHSLRSLPNKHVDTGMGFE
RLVSVLQDKSSNYDTDVFSPLFQKIQEITKARPYGGKFGAEDVDGIDTAY
RVIADHVRTLTFAIADGGVPNNEGRGYVVRRVLRRGARYARRYFQAPIGE
FFSKIVPTLVLQLGDVFPEIKKKESDVKEILNEEEESFSRTLDRGERMFD
VFSKRATEHNSKVLKGSDVWRLYDTFGFPVDLTRIMAEENGLEINEEEFE
RAKAESKEASKARKSSGDVELLKLGVHDLGRLEQMAEVPKTDDVYKFGRG
NITGHIMAIYCDKSFRSSTANISRYTQLGLILDKTNFYAEQGGQEYDTGK
ILIDGEAELDVQNVQVYGGYVLHTGYIKYGTLSVGDDVICEYDELRRWPI
RNNHTGTHVLNYALREVLGDGIEQKGSLVAAEKLRFDFSHKCGVTDAELE
MIEKISTEYIRQNLEVYSEDVPLSIAREIEGVRAVFGETYPDPVRVVSVG
VPIEELTRDVKNKQWRKVSIEFCGGTHVQKTDDIKDLIILEENGIAKGIR
RIVAVTGNDAGKVQKIASQFEERINALGKLPAGPRKEAEIKSVQADLNSL
VISAVKKVQLKDKFGKIHKQLLDDQKAKQKAELKKAVEIVTEHFKQNPDS
PYFVSKLPISANSKALSDAIKHVQTKAKDKTVYLFATDDDAEGKVIHGCY
VAENVGKQLSAKDLADSISQIVGGKAGGKGATSQGIGNKVDKVGEAVDAA
AKALQQLNL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig157 alanyl-tRNA synthetase, cytoplasmic [Coccidioides immitis RS]0.0
Contig5992 alanyl-tRNA synthetase, cytoplasmic [Coccidioides immitis RS]1e-121
SY0AAA59YF14FM1 No hit found
SY0AAC57YL18FM1 alanyl-tRNA synthetase [Aspergillus terreus NIH2624]4e-61


Manual Annotation:

Please find below the necessary files for GSTUMT00007997001 annotation :

link to GSTUMT00007997001 Artemis file
link to scaffold_41 sequence file
link to scaffold_41ESTs