Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007972001
Length(AA) : 381
Localization : scaffold_40
Number of EST contigs matching the gene: 3
Number of ESTs : 13
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein AN8415.2
Specie: [Aspergillus nidulans FGSC A4]
Accession: ref|XP_681684.1| Score: 1023 E_value: 1e-109
KEGG Definition: hypothetical protein
Accession: ani:AN8415.2 Score: 1023 E_value: 1e-109
KOG Definition: Medium-chain acyl-CoA dehydrogenase
Classification: [Lipid transport and metabolism].
Kog Number: KOG0140 Score: 334 E_value: 6e-32
PFAM Definition: Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, middle domain. Central domain of Acyl-CoA dehydrogenase has a beta-barrel fold..
Pfam Number: pfam02770 Score: 155 E_value: 4e-11
Swissprot: P28330|ACADL_HUMAN
Gene Ontology:
GO:0004466 = Molecular function: long-chain-acyl-CoA dehydrogenase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.066NO0.233NO0.063NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1830.0920.754_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.43519First60=0.1017PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007972001
MCKSSLNSSVDSLAVMKYDPGLGFLRKQQDPSKQNIQANNLTLSVTLAAV
LPFSEPPYPNGLPSPYYAPLHHRWQKACCAFISENLTANALEWEREELVP
PEIFSKFAAANFLLPSLPAPLLIEWAKQLGLDILARGLKVEEFDYLHFLI
YSDEMTGNGLSGPGASLTTGITFGVPPILKFGSKQLLERFIPDLLMGRAR
SCIVITEPGTGSDVAGIERTAVKSADEKEYIVNGSKKWITNGIWADFVTT
AVLTGGPWPSGLSLLLIPLKNNLSIIIRKLVIMGLAASGTTYIEFDDTHV
PVENLIGIEGMGIRCIMTNFNHELLTTAIGVTRQARVAVSTALEYVLKRE
AFGKALVEQPVVRHRLAKVGAMVESMWAWVE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1756 hypothetical protein AN8415.2 [Aspergillus nidulans FGSC A4]1e-135
SY0AAD30YA21FM1 hypothetical protein AN8415.2 [Aspergillus nidulans FGSC A4]4e-20
SY0AAD9YP16FM1 hypothetical protein AN8415.2 [Aspergillus nidulans FGSC A4]5e-47


Manual Annotation:

Please find below the necessary files for GSTUMT00007972001 annotation :

link to GSTUMT00007972001 Artemis file
link to scaffold_40 sequence file
link to scaffold_40ESTs