Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007948001
Length(AA) : 376
Localization : scaffold_40
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein FG09564.1
Specie: [Gibberella zeae PH-1]
Accession: ref|XP_389740.1| Score: 915 E_value: 1e-96
KEGG Definition: hypothetical protein
Accession: fgr:FG09564.1 Score: 915 E_value: 6e-97
KOG Definition: Histone H3 (Lys4) methyltransferase complex
Classification: [
Kog Number: KOG2626 Score: 484 E_value: 3e-49
PFAM Definition: SPRY, SPRY domain. SPRY Domain is named from SPla and the RYanodine Receptor. Domain of unknown function. Distant homologues are domains in butyrophilin/marenostrin/pyrin homologues..
Pfam Number: pfam00622 Score: 140 E_value: 2e-09
Swissprot: O60070|ASH2_SCHPO
Gene Ontology:
GO:0000785 = Cellular component: chromatin
GO:0048188 = Cellular component: COMPASS complex
GO:0048189 = Cellular component: Lid2 complex
GO:0006338 = Biological process: chromatin remodeling
GO:0051568 = Biological process: histone H3-K4 methylation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.161NO0.478NO0.114NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3490.0430.705_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00016First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007948001
MISELPVRYPFLSNLRANVDSPMNRRGFRYTPCEASRMLPTVSYRNTEYA
PYAPRINFEDMNAAVHVNRNGSAITTAKGWRMARANVGVREGDWYYECKI
VRGIPSGGHVRVGWARREAPLDAPVGFDGYSYGIRDLSGQKVHMSRPKDF
LEENFEEGDVVGLRICLPSLDVQRGLTEDPVVRARDLIRDRIPIRFKNQL
WFEQFDYQPTKDMEELMNPSPGAKACTPPKTLPNSLIKVYKNGKYVGTPW
EDLFAFLPPASRPLATAGGRELDDGTLGYYPAVSVFRGAIVETNFGPDWL
APPDVEDISGMRPLCERYNEQIAEDITYDIVDEVGLLFTKVPGVDDATAA
PGVAAEGGENGGLVKEEIKEMVMEDE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4075 Ash2-trithorax family protein [Schizosaccharomyces pombe 972h-]8e-16
SY0AAB17YD18FM1 hypothetical protein CHGG_03862 [Chaetomium globosum CBS 148.51]2e-36


Manual Annotation:

Please find below the necessary files for GSTUMT00007948001 annotation :

link to GSTUMT00007948001 Artemis file
link to scaffold_40 sequence file
link to scaffold_40ESTs