Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007944001
Length(AA) : 631
Localization : scaffold_40
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: No Hit Found
KEGG Definition: No significant hit
KOG Definition: Translation initiation factor 3
Classification: [
Kog Number: KOG2072 Score: 116 E_value: 2e-06
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.303NO0.401NO0.174NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6560.0440.311M4114

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00019First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007944001
MPRATRNNSSGPLVSLPYGPRSKRKAPPVTEEERGLGEQEATTQGIGGFI
SPIVIDQDSESSPTLPSRPRKRVRATTLEVRGDDVVEAAEPAIEARLPLA
TRRPRRSPRKSLPWDIVAAGAQKAAGKPRSSAQNNRNRSSLATMEAREKG
LAEETERRIEEGIPSEDEEGGGARLSASHDPLQLKEKQPADRHTTLLSPR
EEQAPSGSEDGHGDLLPADRSQESPEKVVEELMNNVVTSAIAQIDEIEEE
EVEDLESESNDVEFNPRNYEDVDEAIRKQLSAEADGGENGEVEVGSEPVA
SGEDDPQCEMSLATALGAKLEKSREALQTFKEQLEATTGTANQLMELRDG
IDSRSGYTRILREIIRKLAEEERPDNGALEALADFSLNISSMVSEIRDAH
RDVEALLENLGAGIISGTRSAQMVETMLEQRGFEEEAPRDGINWKRINRN
SVVRENEALASAKLNPVEPQTPMRSTRSNPSRYRTQGALPTPEARPPPSV
PSSHDSLSDLEFLGSTAPVIGDDAPVEIVRIESFGSRPSNTPRRSKRRRE
SEDDDSPQVREDRAWSSPELKALFRRLAQVQKAEPGKVIVLDSRSGYTRT
KEEILIKAKEIKDDMVRSGRAGTLKPIWDDI

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB8YK17FM1 No hit found
SY0AAD59YA02FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00007944001 annotation :

link to GSTUMT00007944001 Artemis file
link to scaffold_40 sequence file
link to scaffold_40ESTs