Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007910001
Length(AA) : 1556
Localization : scaffold_4
Number of EST contigs matching the gene: 3
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE57037.1| Score: 970 E_value: 1e-102
KEGG Definition: ankyrin repeat
Accession: aor:AO090001000528 Score: 970 E_value: 1e-102
KOG Definition: Ankyrin
Classification: [Cell wall/membrane/envelope biogenesis].
Kog Number: KOG4177 Score: 354 E_value: 2e-33
PFAM Definition: No Hit Found
Swissprot: O89019|INVS_MOUSE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.058NO0.101NO0.083NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2560.0810.679_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=36.9808First60=0.00015PredHel=1
Topology=(1502-1524)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007910001
MRWLSPLEPNNRHEGVRADRFDGVGDWVLEAREFREWRGGEGGVDEAVLF
CSGNPGVGKTYLSSLVIDSLCDQARKGDIAVAGLYCDFLAQQEQTLLNMI
GAILKQLVGRGGIPKYLREAFEEGKSELGGRRLLLPDLMRMLGTTIASLP
RVFICIDALDEFLPKGLPKLLESLRDIVRESPTTRIFLTGRPHVSEDIQR
PFGKMVVVPIIPTIDDIRSYLEMRLNADADLEAMNDDLRADIIGAALEKI
SEIFLLVALNIDAILEEVTIRQRRKKLEEMRKGNGLSDAYTATLTRLKAQ
KGNKSVLGLRVLMWVMYSERPLRAEELCHALGVEIGSTDLDVENVPSLRT
LLASCLGLVTVEASSSTVRLVHYTLQEHLSRDPTLFHSPHSEIAEVCLTY
LNFECVRDLSPALYGAPATTPLLEYASYYWGDHTRRGMTENVKALALRLL
DRFDEHISAQLTLLRYNRDRSSGPYFDAARGPIGFTGLHGAAFLGIVGLL
VAILKMKEWDVNATDRIGSTALTWAAIRGHEEAVDVLLDREDVRPDQADT
KTGRTPISWAAVCGHERVVKILLERGDINPDHADTEDGSTPLLLAAIGGH
QKVVKMLLERGDVNPDLPDTSFGLTPLSWAAERGSEGIVKILLERADVNI
NHIDTEYGQTPLSWAAENGHEGVVRILLERKDVHIAALDRANQTPLSKAL
SKRHDRGGVDKPVLFCSGNPGVGKTYISSLVIDSLCDQAGKENIAVAGLY
CDFLAQQEQTITNVMGAIFKQLVARGDMPNDLREAFEKAKKGFGGRRLLL
PDLVKMLRTAIASLPIVFICIDALDEFSPKHLPELLKLLGDIVRESPTTR
IFLTGRPHIREDIQRHFSKAVVIPISPNTDDIRSYLETRMAGDTDPEAMS
DDLRADIIRVILERTSDIFLLVSLNIDAILGEVTIRKRRKKLETIAKGNG
LSDAYTATLTRLKAQKGDKSILGLKVLMWVLYSERPLKAKELCHALGVEV
GSTDLDVENVPALRTLLASCLGLVTVEASSSTIRLVHYTLQEHLSTHPTL
FHSPHSTIAEVCLTYLNFKCVRDISPIRDSAPATMPLLDYASCYWGEHTR
RGMTENVKALALRLLDRFDEHIAAKLLLLQDNGKPYFYYSEERRPIGFTG
LHGVAFIGIVEIVAAILKMKEWDVNATDGLGSTALTWAAGRGHEEVVEVL
LNREDINPDQPDTKYGRTPLLWAAEIGHEGIVKLLLQRDVNPDQPDTKYG
GTPLSLAAGRGHEGIVKMLLERDVNPDQPDTKYGRTPLSWAAKNGHEGIV
KMLLERDVNPDQPDTENGRTPFSWAAGNGHEGIVKMLLERDVNPDQPDTK
YGRTPLLSAAGNGHEGIVKMLLERDVNPDQPDTKYGRTPLSWAAHHGREG
VVKMLLERKDVHTDTPDSENQTPLSLARAKGHDRIVNMLHERDSVNSHTA
DRLARNSSPPPLAMQPSAADMPITDPNDPEPVSDLEDSSPKPADGDPPLT
EESLPQAGIHPHDPPSIPPYPQPVARYFAIAFFVCLLALLVHILPSSFPE
IFRLHQ

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA45YI05FM1 unnamed protein product [Aspergillus oryzae]1e-06
SY0AAB42YF07FM1 predicted protein [Aspergillus terreus NIH2624]5e-21
SY0AAC15YC24FM1 Ankyrin repeat protein [Neosartorya fischeri NRRL 181]1e-21


Manual Annotation:

Please find below the necessary files for GSTUMT00007910001 annotation :

link to GSTUMT00007910001 Artemis file
link to scaffold_4 sequence file
link to scaffold_4ESTs