Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007846001
Length(AA) : 444
Localization : scaffold_4
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : MANTUM00007846001  [+]

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001539257.1| Score: 1288 E_value: 1e-140
KEGG Definition: 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases
Accession: aor:AO090701000891 Score: 1233 E_value: 1e-134
KOG Definition: Kynurenine 3-monooxygenase and related flavoprotein monooxygenases
Classification: [Energy production and conversion
Kog Number: KOG2614 Score: 316 E_value: 1e-29
PFAM Definition: FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes..
Pfam Number: pfam01494 Score: 197 E_value: 5e-16
Swissprot: P23262|NHG1_PSEPU
Gene Ontology:
GO:0018658 = Molecular function: salicylate 1-monooxygenase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.756YES0.960YES0.558YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.290.6480.044S423

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=22.1196First60=22.1182PredHel=1
Topology=(7-29)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007846001
MGRACIRLNVIVVGAGLGGLGAAIAISLAGHRVTVLEASPTAGEIGAGIQ
IHPNASKILTAWGMREALLQYATLPKQVNMIGWKGNHISHMNFAEHAKRY
NSPFWDFHRASLHKCLLDRAVELGSKVLMNSRVDHVEFGQLGGACTVLLH
NGRRLSADLVVGADGINSVMRERLVGRPDKPTPTGDLAYRLLIKTKDMME
DPELRGFVTDPQVNYWMGPDAHAVNYVLKGGEEFNMVLLVPDDIPEGGAT
TVEGNVDEMRAIYKDWDPRIGKLLALCESVYKWKLCIREELPNWSHPSGT
FTLLGDSAHATLPYLASGAGMSLEDAAVLGECLSRISSKSDIPLALSVYE
KCRKKRTTRIVQRGNFQQYLYHLHDGPEQQERDAKMRMVPTPPGECLPWR
DPGFAPWLLGYEGLKDVEACWPKDMEGGRGGIRERGDGEIRAKL

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA63YL20FM1 hypothetical protein SNOG_04188 [Phaeosphaeria nodorum SN15]7e-33


Manual Annotation:

Please find below the necessary files for GSTUMT00007846001 annotation :

link to GSTUMT00007846001 Artemis file
link to scaffold_4 sequence file
link to scaffold_4ESTs