Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007824001
Length(AA) : 839
Localization : scaffold_4
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CHGG_04534
Specie: [Chaetomium globosum CBS 148.51]
Accession: ref|XP_001223748.1| Score: 1196 E_value: 1e-129
KEGG Definition: hypothetical protein
Accession: ani:AN3547.2 Score: 1064 E_value: 1e-114
KOG Definition: Kinesin light chain
Classification: [Cytoskeleton].
Kog Number: KOG1840 Score: 392 E_value: 3e-38
PFAM Definition: No Hit Found
Swissprot: Q6AZT7|NPHP3_XENLA

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.171NO0.347NO0.116NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5990.0290.451M567

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00135First60=0.00038PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007824001
MHRRALAGREKTLGLRHLDTLQSVNNLGTTLSKQGKYGEAEVMHRRALEG
REKALGLDHRDTLQSVRDLGVALNRQEKYDEAEITHRRALVGREKTLGPD
DRDTLQSIRDMGVVLHCQEKYREAKKMHRRALAGAERTLGLDHRDTLQSS
VNNLGTTLRSQGNYGEAEVMHRRALAGREKAFGLDHRDTFESIHDLGVAL
HCQEKYAEAAGMHQRALGGRENTLGLDHQDTLQSVNNLGTTLYSQGKYDQ
AEIMHRRALVGREKKLGLNHQDTLATVDSLGTTLNSQGKYNEAEIMHRRA
FIGRETALGLDHRDTLWSVNNLGTTLRSQGKYEEAVVMHRRALAGRERTL
GPDHRKTLWSVNNLGTTLRSQGMYNEAEIMYLRALAGREKILGLDHPDTL
QSVRDLGVALYRQEKYNEAEIMHRRAFEGQEKMLGLGNRDTPHSVNNSGA
VLHDQTMNNKTEIVHPDATVGAQSSLGTHRADFLQGVFRLAVTLLTERKY
EEAEIMYRHGLGAMEKVLVTNHPGALDSMNMLGETLLDLERYDEAEAMCR
RALAGREKSLGVDHPATLTSADNLGRILYHQRKYEEAEILFQSTKVGRKK
VLGLYHPDTLLSALRLGVTLLDRKKYGEAETIYQHALGVMENALGPDHPE
VLDSMNTLAETLLDLKKYSEAEAMCRRALAGREKTLGLDHRDTLLSINNL
GVALRNQDKHHEAEISYRRALIGAEKTLGLDHRDTLVCIYNLAGALHRQR
KYDEAEMMHRRALAGREKILGLGHRHTLRSLIKLGAVLHENRKYDEAEIM
YRRAVTEAERALGPGHHVTLKNFNNLSMFLYARETRPSN

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB2YE10FM1 conserved hypothetical protein [Ajellomyces capsulatus NAm1]2e-56


Manual Annotation:

Please find below the necessary files for GSTUMT00007824001 annotation :

link to GSTUMT00007824001 Artemis file
link to scaffold_4 sequence file
link to scaffold_4ESTs