Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007808001
Length(AA) : 281
Localization : scaffold_39
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein
Specie: [Yarrowia lipolytica]
Accession: ref|XP_501100.1| Score: 801 E_value: 1e-83
KEGG Definition: hypothetical protein
Accession: yli:YALI0B19558g Score: 801 E_value: 6e-84
KOG Definition: Methyltransferase-like protein
Classification: [General function prediction only].
Kog Number: KOG3115 Score: 886 E_value: 4e-96
PFAM Definition: Methyltransf_4, Putative methyltransferase. This is a family of putative methyltransferases. The aligned region contains the GXGXG S-AdoMet binding site suggesting a putative methyltransferase activity..
Pfam Number: pfam02390 Score: 465 E_value: 2e-47
Swissprot: Q12009|TRM8_YEAST
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0005515 = Molecular function: protein binding
GO:0030488 = Biological process: tRNA methylation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.052NO0.109NO0.037NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2440.0410.756_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.15025First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007808001
MSTPPTTSTSTSPPAKRQKPSNGERTGHRSAYRSDLTRQGLPQKKHYRQR
AHANPFSDHQLVYPPCPADMDWSKHFSSPISTSTTTPEEKRVEVADIGCG
FGGLIISLPKVLPGVRMLGMEIRTQVTEYVDERIRALRRLAGGEAYADVG
VIRANAMKFLPNFFERSQLQKVFLCFPDPHFKARKHKARIVSPTLASEYA
YVLAPAGVLYTITDVEDLHHWMAKHFDEHPLFERLIGEEVDGDVCIAVMR
TDTEEGKKVERNGGRKFVACWRRREDPEWVE

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB18YD22FM1 probable t-RNA methyltransferase [Neurospora crassa]2e-48


Manual Annotation:

Please find below the necessary files for GSTUMT00007808001 annotation :

link to GSTUMT00007808001 Artemis file
link to scaffold_39 sequence file
link to scaffold_39ESTs