Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007744001
Length(AA) : 348
Localization : scaffold_39
Number of EST contigs matching the gene: 2
Number of ESTs : 16
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_05094
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001593666.1| Score: 770 E_value: 7e-80
KEGG Definition: hypothetical protein
Accession: ncr:NCU09794.1 Score: 633 E_value: 2e-64
KOG Definition: Predicted oxidoreductase
Classification: [General function prediction only].
Kog Number: KOG2742 Score: 267 E_value: 3e-24
PFAM Definition: GFO_IDH_MocA, Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilise NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot..
Pfam Number: pfam01408 Score: 213 E_value: 5e-18
Swissprot: Q04869|YM94_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0005634 = Cellular component: nucleus
GO:0005515 = Molecular function: protein binding

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.295NO0.795NO0.236NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0410.6340.483S525

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00656First60=0.00078PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007744001
MAPIGIAILGCGIFVQEEHLPAVEACSDVVLKAVYSRSEASAKKLLQAKS
GVDIYSDDSENGLGVLLARSDIQAVIIALPITIQPEVIKKALGAGKHVLS
EKPVAKDLAQARELISYKQSYPDLNWSVAENFRFQEAWRHAHREITALGR
VINFRSRVCWLVTPGWKYYETSWRKTPDYQGGFLLDAGVHYAASMRILLS
DEKIVKVSAFTASNFEHLPPVDTISAIFKTDKGVVGSFEVSVGTTFEGWE
FAVACENGSVTVRPVSEVVILRRKPGGGFEDEIVKKFPDDKKGVGPEVAA
FAKAVIAGAPDERQTPELAVGDLEMIEKMLRSGENDGAVMEINGGLTA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1796 hypothetical protein SNOG_10185 [Phaeosphaeria nodorum SN15]8e-68
Contig2212 hypothetical protein SNOG_10185 [Phaeosphaeria nodorum SN15]2e-54


Manual Annotation:

Please find below the necessary files for GSTUMT00007744001 annotation :

link to GSTUMT00007744001 Artemis file
link to scaffold_39 sequence file
link to scaffold_39ESTs