Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007728001
Length(AA) : 456
Localization : scaffold_39
Number of EST contigs matching the gene: 1
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_10184
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001800466.1| Score: 1092 E_value: 1e-117
KEGG Definition: hypothetical protein
Accession: fgr:FG02630.1 Score: 997 E_value: 1e-106
KOG Definition: RNA pseudouridylate synthases
Classification: [RNA processing and modification].
Kog Number: KOG1919 Score: 783 E_value: 7e-84
PFAM Definition: PseudoU_synth_2, RNA pseudouridylate synthase. Members of this family are involved in modifying bases in RNA molecules. They carry out the conversion of uracil bases to pseudouridine. This family includes RluD, a pseudouridylate synthase that converts specific uracils to pseudouridine in 23S rRNA. RluA from E. coli converts bases in both rRNA and tRNA..
Pfam Number: pfam00849 Score: 400 E_value: 2e-39
Swissprot: Q09709|YA32_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.162NO0.409NO0.186NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4570.0660.468_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00129First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007728001
MHPKINLLITLRELVNISRRKYAMDTLPFKSSPGLSPIVFGSQEEVEKGP
SSASSSSSSKAGEGQSTKGRVSVPMVAQKDTAPKPPKFVNPPPVPQYSFE
DGLRRVPPYQFSYNTYCKERWRGKGVLEVFWSEFRDRPLEYYGMNGGGAQ
LASMQTIIASVDSKLENGDMLVHTLHRHEPPVTAKPIETVYEDDRLIVIN
KPAGVPVHPAGRYNFNTVIEIMKHDYNGHAPLPCNRLDRLTSGLMFMAKT
PEAANDFMGQLQTRTIKKQYLARVKGKFPAGEVTCSQPILSVSPKLGLNR
VRASGKTAKTLFKRLKYNTEKNYSIVECHPFTGRTHQIRVHLQFLGHPII
NDPIYCNRNVWGPALGKGGEGEDEEIIERLNKVGREEEVRYEEIIEDYEG
RKAEKLTGKRCEVCDTPLFSDPGLHELGIYLHAKRYECEDGQWGYETELP
EWATED

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig126 hypothetical protein CIMG_09505 [Coccidioides immitis RS]8e-25


Manual Annotation:

Please find below the necessary files for GSTUMT00007728001 annotation :

link to GSTUMT00007728001 Artemis file
link to scaffold_39 sequence file
link to scaffold_39ESTs