Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007719001
Length(AA) : 202
Localization : scaffold_39
Number of EST contigs matching the gene: 1
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: GTPase Rab7
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001554031.1| Score: 795 E_value: 3e-83
KEGG Definition: Ras-related GTPase; K07897 Ras-related protein Rab-7A
Accession: aor:AO090120000329 Score: 779 E_value: 1e-81
KOG Definition: Ras-related GTPase
Classification: [General function prediction only].
Kog Number: KOG0394 Score: 820 E_value: 1e-88
PFAM Definition: Ras, Ras family. Includes sub-families Ras, Rab, Rac, Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025, pfam00063. As regards Rab GTPases, these are important regulators of vesicle formation, motility and fusion. They share a fold in common with all Ras GTPases: this is a six-stranded beta-sheet surrounded by five alpha-helices..
Pfam Number: pfam00071 Score: 533 E_value: 2e-55
Swissprot: Q9C2L8|RAB7_NEUCR
Gene Ontology:
GO:0005886 = Cellular component: plasma membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.326NO0.747NO0.268NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2240.0890.522_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.0451First60=0.04334PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007719001
MATRKKFLKVIILGDSGVGKTSLMNQYVNKVFSVSYKATIGADFLTKDVM
VDDRLVTLTLWDTAGQERFQSLGVAFYRGADCCVLVYDVNNAKSFDNLNS
WRDEFLIQASPRDPDTFPFVVLGNKIDVDESKRRVSNKRAQAYCLSKGQL
PHFECSAKDGANVEVAFEAIARQALAQDESEIDYFDPTVNTGFPIESDGC
SC

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1287 GTPase Rab7 [Botryotinia fuckeliana B05.10]9e-76


Manual Annotation:

Please find below the necessary files for GSTUMT00007719001 annotation :

link to GSTUMT00007719001 Artemis file
link to scaffold_39 sequence file
link to scaffold_39ESTs