Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007718001
Length(AA) : 430
Localization : scaffold_39
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_09222
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001239601.1| Score: 593 E_value: 3e-59
KEGG Definition: integral membrane protein, putative
Accession: afm:AFUA_5G12140 Score: 585 E_value: 1e-58
KOG Definition: Predicted membrane protein
Classification: [Function unknown].
Kog Number: KOG2765 Score: 853 E_value: 4e-92
PFAM Definition: UAA, UAA transporter family. This family includes transporters with a specificity for UDP-N-acetylglucosamine..
Pfam Number: pfam08449 Score: 143 E_value: 1e-09
Swissprot: Q03730|YMB8_YEAST
Gene Ontology:
GO:0000329 = Cellular component: membrane of vacuole with cell cycle-correlated morphology

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.117NO0.729NO0.137NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1440.3990.585_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=206.567First60=7.28668PredHel=10
Topology=(54-76,86-108,162-181,186-208,215-234,254-276,289-311,321-343,350-372,376-393)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007718001
MSTSPLPPIHASFSPPPDFIVPLLPPPPARPSSLPLMPKPQPIRIRVFPR
RKTIGILLLGVVIFLWVLSTFLTFTIFSDGSYTKPYFVTYVNTCSFCFYL
LPGAWRAWRGKCEERDRSRVGYARLGNVPLPRAVGEDEDRDGVIMASKSL
VVEGEGMLSERETILLSLQFCLLWFVANYFQSYCLKWTSVASATILSSTS
SIFTLMLGALLRIERFTWTKFLAVVLSFTGVSLVSSVDLSPSSSLSPGAG
DKTPGQILRGDLMALMGAFSYGVYTILLKVRIGHESRISMTRFFGFVGLF
NFLVLWPGIIILHHAGVEKFEIPPDARIWWIVVINASITLISDYCWVYAM
LLTTPLIVTVGLSLTIPLALLGQMLVLGVWSSGVYWIGAVLVFLAFLFVN
RESVVDDIGGGEGEGGVVVDVEGETGRWER

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1782 hypothetical protein CIMG_09222 [Coccidioides immitis RS]9e-30
SY0AAC19YN06RM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00007718001 annotation :

link to GSTUMT00007718001 Artemis file
link to scaffold_39 sequence file
link to scaffold_39ESTs