Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007715001
Length(AA) : 297
Localization : scaffold_39
Number of EST contigs matching the gene: 3
Number of ESTs : 35
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein
Specie: [Yarrowia lipolytica]
Accession: ref|XP_503268.1| Score: 345 E_value: 1e-30
KEGG Definition: hypothetical protein
Accession: yli:YALI0D25278g Score: 345 E_value: 5e-31
KOG Definition: No Hit Found
PFAM Definition: Heme_oxygenase, Heme oxygenase..
Pfam Number: pfam01126 Score: 176 E_value: 9e-14
Swissprot: P32339|HMX1_YEAST
Gene Ontology:
GO:0005783 = Cellular component: endoplasmic reticulum
GO:0016021 = Cellular component: integral to membrane
GO:0020037 = Molecular function: heme binding
GO:0004392 = Molecular function: heme oxygenase (decyclizing) activity
GO:0004601 = Molecular function: peroxidase activity
GO:0006879 = Biological process: cellular iron ion homeostasis
GO:0042167 = Biological process: heme catabolic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.060NO0.242NO0.065NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2340.0520.79_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=22.5161First60=0.00075PredHel=1
Topology=(270-292)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007715001
MAHHQHFHTRAEKESQGLWSLSQQINAATREGHDRVNVMIMNRLSLGLRD
YKLYREGIFSFCQVYRAFEDAWMAAISSEATTDPRIKTALQNLYSLPLLR
APQLFKDLEYFSDQETHHMALLKWPVRAEYVSHIKRVLSQKPHLVIAYTH
NYYMALFAGGKILKHQISQARGFFPGRGNMTAEECKAAGMNLFSFEVPKG
KEDSLRSGFKGALEDIQSTLTDEERTEIIEESKVIFKNNELLILELDHIC
AAMTPSPRSTGILTLRENRVTAFIWAYKLEILFVMVFCYAAVKLFFF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3892 No hit found
Contig5225 hypothetical protein [Yarrowia lipolytica]2e-30
SY0AAC39YI05FM1 hypothetical protein [Yarrowia lipolytica]4e-09


Manual Annotation:

Please find below the necessary files for GSTUMT00007715001 annotation :

link to GSTUMT00007715001 Artemis file
link to scaffold_39 sequence file
link to scaffold_39ESTs