Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007694001
Length(AA) : 304
Localization : scaffold_38
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : Tmeloac1  [+]

Blast Results:

Nr Definition: mitochondrial oxaloacetate transporter (Oac), putative
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP51973.1| Score: 1142 E_value: 1e-123
KEGG Definition: mitochondrial oxaloacetate transporter (Oac), putative
Accession: afm:AFUA_5G12360 Score: 1142 E_value: 1e-123
KOG Definition: Mitochondrial oxaloacetate carrier protein
Classification: [Energy production and conversion].
Kog Number: KOG0755 Score: 945 E_value: 1e-103
PFAM Definition: Mito_carr, Mitochondrial carrier protein..
Pfam Number: pfam00153 Score: 218 E_value: 1e-18
Swissprot: Q9UTN1|OAC1_SCHPO
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.450NO0.870NO0.404NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1120.3690.458_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=69.1416First60=19.5861PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007694001
MSTTLGGFIAGGIAACGAVTVTHGFETVKTRLQLQGELSAKSQTKRVYTG
VFQGVRVILVNEGPRGLMAGLGAAYCYQTMLNGCRLGFYEPIRSSATRLV
HSDPHHQSIGVNVFAGATSGILGAMVGSPFFLVKTRLQSYSPSLPVGTQH
NYRNALDGFRTISRTEGFKGLYRGVGSAMVRTGFGSSVQLPTYFFAKRRL
QKYLGLREGVGLHLASSAVSGFVVCCVMHPPDTVMSRMYNQSGNLYTNAF
DCLMKTVRTEGLLAIYKGYFAHLARILPHTILTLTLAEQTNRLVRKVEQR
LFLD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig5592 mitochondrial oxaloacetate transporter (Oac), putative [Aspergillus fumigatus A1163]2e-80
SY0AAA56YE10FM1 mitochondrial carrier protein [Neosartorya fischeri NRRL 181]4e-17


Manual Annotation:

Please find below the necessary files for GSTUMT00007694001 annotation :

link to GSTUMT00007694001 Artemis file
link to scaffold_38 sequence file
link to scaffold_38ESTs