Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007680001
Length(AA) : 783
Localization : scaffold_38
Number of EST contigs matching the gene: 3
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: No Hit Found
KEGG Definition: No significant hit
KOG Definition: Actin regulatory protein (Wiskott-Aldrich syndrome protein)
Classification: [Signal transduction mechanisms
Kog Number: KOG3671 Score: 259 E_value: 7e-23
PFAM Definition: Drf_FH1, Formin Homology Region 1. This region is found in some of the Diaphanous related formins (Drfs). It consists of low complexity repeats of around 12 residues..
Pfam Number: pfam06346 Score: 268 E_value: 7e-24
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.060NO0.163NO0.048NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2990.0660.636_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.56284First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007680001
MSFPRPHTSQGRPGQFQDDPDPKLQFELPPFDPDHRGEFDDGPRGRDFRP
QIHQDNPPRHNPVPNTSALRRASVGRGLHSEMSRGMPGAFPGGGIGGGGD
GGQRGPVVIHGRLPETRYVCFKKKTSGTSWVSGRTVCEHITKDIGPEATE
RRIRRHENPGMGILAILSKMAYYQQQHIHLQEDRLNEAEKGPGWHWVISA
VGKEKATKAFWAIYSRLPKSQKGHQHRHSIGGPLPQMPLGEPKGRPSLHQ
QHQHHHQRQGPDSFKVQPVQIPPPPRPSNFLSTDLPSPPGAFPQNLYGEE
EPFRSGNFGGVPPLEPPRAPSRPNPNFDFSDGPRIIEVEPPIPGAFPQYQ
DHHQQQQQGREESFLRSNIRNHLPQGTFGAVDSYSSVPGNRSSMPAMPAM
PGGLGDMGGGGMGGGMGGGMGGGMGSGMGSGMGSGMGGGMGGGMGGGMGG
GMGSGMGGGMGGGMGGGMGGGMGGGMGGDMGGGMGGGMSGTGGMPNGMPG
GMLGGMPNGLRGDHPPRDADIHDPRGRDSRPTSQQMPRHDPPMDPHRSNS
HHRGPSSQPRRRRNSSFHNESFPPYRESHHPRRGRAATNPNRATMDSTYW
DSDKMHRTDEWVDSVSNSSGVGSTSSSQDGYLGANGDYVLDTPPPARRRS
ISVHGERERDREYHHPLHRGRSFREPHRHSTYNTGAGRPAIEYEYAVAPR
NGGSGGRPRYRTAYHGMDSRQRRRSLSRRRSGYFGDRGHEYEYESADDIA
NGMRDLRIDSGRGEGRRQSMYERYMDTGMVAYV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig987 No hit found
Contig1062 No hit found
SY0AAA19YK09FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00007680001 annotation :

link to GSTUMT00007680001 Artemis file
link to scaffold_38 sequence file
link to scaffold_38ESTs