Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007672001
Length(AA) : 735
Localization : scaffold_38
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE62857.1| Score: 451 E_value: 2e-42
KEGG Definition: predicted protein
Accession: aor:AO090120000253 Score: 451 E_value: 8e-43
KOG Definition: Transcription regulator dachshund
Classification: [
Kog Number: KOG3915 Score: 158 E_value: 4e-11
PFAM Definition: Atrophin-1, Atrophin-1 family. Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity..
Pfam Number: pfam03154 Score: 155 E_value: 8e-11
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.259NO0.674NO0.193NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0910.2140.771_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00148First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007672001
MVLAICPFSLLDSNDPSGQTLTSEIDNYKRRGRYIEGKMDPPTTPESGLF
HPARDSMQVHSETHSGYTSSNEDHFSDAPEGPDAVAEVDNDKRLPTSPPL
PPSLPSIPLVLVEKIDERPSHGEVPGTGAFEGRTAGARPDVIRIQPLPDL
LAAVPRAFGDNPEGEEQEKEEESKGEVETSRSDVPITIVERVGSTPAHGE
IPGTEAFAKRLVDAAPDVIRTATTSPIPTTVVSIVDSDKPLHGEVLGTEA
YKMRAADAQPDVVVKWNEEEDKIARRVKSERERIEKLMMNPGRARSVSPG
QGPKSVAPAVKGRVDSVSITLPIGEPEGKEGKEKEINGVEKGGKEDDTVK
EQPLRSQSPISSQKCGPPVPVGEPEITHDAPIGAGVERAKEETKEVPAEE
SGAEDAKEEVKGQVIDGVNAGKNGKVEEREEDEAAEEEEKEETTAKEDEI
RGEEAEDDDGFGDDDFDDFGEVVEGEEFDDFGGFGEAEAFEPPPVEAAPP
PAPPQIPVIPVPVLDFERLDDEDTIRRAAAEAMAIMFPIDKEKYKSITPI
SIDDNAFLTERSLSLWNQLSAPPPLQPPNWKMSRIRRLFLVSLGVPVDLD
EILPAETKQKKLVLPSVNIARKSIDESAGRRNSRSRSRARRSTSSSRRKS
GVIGPEALDVPGARILCSTSDVALWGLTVEELKEHIKKLESITCTASEVL
TYWLKKREGAISDKETFETVIESLVGYARKKRQNG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1787 No hit found
SY0AAB52YI12FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00007672001 annotation :

link to GSTUMT00007672001 Artemis file
link to scaffold_38 sequence file
link to scaffold_38ESTs