Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007570001
Length(AA) : 505
Localization : scaffold_37
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: Ankyrin repeat protein
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP48589.1| Score: 544 E_value: 2e-53
KEGG Definition: hypothetical protein
Accession: ang:An12g05680 Score: 501 E_value: 8e-49
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: Q00808|HETE1_PODAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.071NO0.279NO0.079NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0650.3520.681_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00668First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007570001
MGFTEDVDTLWDILVKAVSEGECGHVICVADALDECEEETIAPLIRHVTR
LPGSQTSDTPLKFLVTSRPYHRFERDLGSPSTTIRLKGEDEVAAITSDIT
RVIDEGIENLESYWGRPGELGYLRTLLKSSADRTFLWVSLVLGILKDSED
GSLEEFTSIVSTAPRDLAGLYTKILDKAASPDKARRILEIVVAAVRPLTL
REMNVAFRIRREHDSIENLEGLPGGFEKTVKNLCGLFVRVIDSKIYLVHQ
TARQFLIQGSIPGQGNWQYTLCPKDSNFTIADICISYLSLDAFAGSALAI
DICGRVSENSVNDYLKKYSFLDYAVQHWADHFRDSQDRGMGLFEFTRLVC
GSGPKHCLTWFQVYWFNTHPLYIFPQDFTHLMIASYLGQGAVVDRLLEEG
GNINARSELHGTALNIAAVKKDRDVTRRLLRKNVKAYLDSKEYNILNVGG
LLVRNYWCITNNKPSLQTVSEFAVTGGARADSERVLRYRRRAEALYHFSL
MLRCC

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB34YD17FM1 hypothetical protein BC1G_06998 [Botryotinia fuckeliana B05.10]1e-26


Manual Annotation:

Please find below the necessary files for GSTUMT00007570001 annotation :

link to GSTUMT00007570001 Artemis file
link to scaffold_37 sequence file
link to scaffold_37ESTs