Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007537001
Length(AA) : 373
Localization : scaffold_36
Number of EST contigs matching the gene: 2
Number of ESTs : 8
  User annotation : Tmelpdh_e1B  [+]

Blast Results:

Nr Definition: pyruvate dehydrogenase E1 component beta subunit, mitochondrial precursor
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001213440.1| Score: 1246 E_value: 1e-135
KEGG Definition: pyruvate dehydrogenase E1 beta subunit PdbA, putative [EC:1.2.4.1]; K00162 pyruvate dehydrogenase E1 component, beta subunit
Accession: afm:AFUA_3G04170 Score: 1235 E_value: 1e-134
KOG Definition: Pyruvate dehydrogenase E1
Classification: [
Kog Number: KOG0524 Score: 1323 E_value: 1e-146
PFAM Definition: Transket_pyr, Transketolase, pyrimidine binding domain. This family includes transketolase enzymes, pyruvate dehydrogenases, and branched chain alpha-keto acid decarboxylases..
Pfam Number: pfam02779 Score: 408 E_value: 2e-40
Swissprot: P32473|ODPB_YEAST
Gene Ontology:
GO:0042645 = Cellular component: mitochondrial nucleoid
GO:0005967 = Cellular component: mitochondrial pyruvate dehydrogenase complex
GO:0004739 = Molecular function: pyruvate dehydrogenase (acetyl-transferring) activity
GO:0006090 = Biological process: pyruvate metabolic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.186NO0.441NO0.149NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.9280.0220.111M114

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=6.37622First60=0.00023PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007537001
MFVARNFLSRAAGNALRKPLVNIHRVTAFQALKAEQKNYSTGGTRDYTVR
EALNEALAEELERDEKVLIMGEEVAQYNGAYKVTKGLLDRFGEKRVIDSP
ITEHGFAGLGVGAALAGLSPVVEFMTWNFAMQAIDQIINSGAKTHYMSGG
IQPCSITFRGPNGFASGVAAQHSQDYSAWYGSIPGLKVVTPWSAEDAKGL
LKAAIRDPNPVVVLENELLYGQAFPMSEEAQKSDFVLPIGSAKIERVGKD
VTLVALSRCVGQALTAAATLKKKYGVETEVINLRSVKPLDVETIVKSVKK
TNHLIAIESGFPSFGVASEILALSMEYMFDFLDAPAQRITGAEVPTPYAI
GLEQLSFPDEDLMVKKTAQLLGL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1983 pyruvate dehydrogenase E1 component beta subunit, mitochondrial precursor [Ajellomyces capsulatus NAm1]1e-121
SY0AAA57YJ16FM1 conserved hypothetical protein [Magnaporthe grisea 70-15]8e-19


Manual Annotation:

Please find below the necessary files for GSTUMT00007537001 annotation :

link to GSTUMT00007537001 Artemis file
link to scaffold_36 sequence file
link to scaffold_36ESTs