Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007521001
Length(AA) : 347
Localization : scaffold_36
Number of EST contigs matching the gene: 1
Number of ESTs : 11
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An18g05750
Specie: [Aspergillus niger]
Accession: ref|XP_001399026.1| Score: 778 E_value: 8e-81
KEGG Definition: hypothetical protein
Accession: ang:An18g05750 Score: 778 E_value: 4e-81
KOG Definition: Uncharacterized conserved protein
Classification: [Function unknown].
Kog Number: KOG3154 Score: 684 E_value: 1e-72
PFAM Definition: DUF367, Domain of unknown function (DUF367)..
Pfam Number: pfam04034 Score: 455 E_value: 5e-46
Swissprot: Q12094|YO006_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0005634 = Cellular component: nucleus
GO:0042802 = Molecular function: identical protein binding

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.020NO0.088NO0.020NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2230.0840.78_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.14492First60=0.00019PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007521001
MAKKKGQRYQGRERRENRGQGERETQKLPFKARCWDLGHCDRKRCSGQKL
MREGLIRSMPLDKKFNGVVITPVGKTVVSPADKELMEKYGAAVVECSWAR
LADVPFHKIGGKCERLLPYLIAANTVNYGKPWRLNCAEALAACFVIGGHT
DWAEQILEPFPYGGSFLEINGELLEKYAACADANDVKSAEAEWLDKLDKE
YKESREGGEDPWMGGNSNLASVSAPGSREATEEPMESQSRSYEMPSSSEE
DGERYHEYLRQKALQSREFTNPKPTKVIKASKVDSDSDEAAYSGEEDDLD
RDKSIFNSARVGEDKEPSIKHSSQKYPRTYTAFLSSKNISASGGQSA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3944 hypothetical protein An18g05750 [Aspergillus niger]1e-80


Manual Annotation:

Please find below the necessary files for GSTUMT00007521001 annotation :

link to GSTUMT00007521001 Artemis file
link to scaffold_36 sequence file
link to scaffold_36ESTs