Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007520001
Length(AA) : 216
Localization : scaffold_36
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_11089
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001587848.1| Score: 239 E_value: 1e-18
KEGG Definition: hypothetical protein
Accession: ncr:NCU02304.1 Score: 223 E_value: 4e-17
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: P32341|VPH2_YEAST
Gene Ontology:
GO:0005789 = Cellular component: endoplasmic reticulum membrane
GO:0005515 = Molecular function: protein binding
GO:0006461 = Biological process: protein complex assembly
GO:0007035 = Biological process: vacuolar acidification

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.482YES0.857NO0.419NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1040.5040.533_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=43.2794First60=0.00023PredHel=2
Topology=(122-141,151-173)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007520001
MVLLTLTSQLTAAIEVYNKENPSSAISLPTTHLDHRQIRIISQTLLNTSE
DKSQYRLSTLLQGCNLYHPPPPPKPEPTQEYKYLMARLRQQEEERIYNAL
TNKPQDIYEEEDEYTFQDLKSQLSIIANVLLSTIATSVAVWMVASGWDVP
QRFALAFASSIVVCVAEVVVFNGYLRKVDKSRRLEKIKAQNEVKEVVNVW
EIGGVARALDGVKKRR

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB44YP17FM1 hypothetical protein BC1G_08075 [Botryotinia fuckeliana B05.10]2e-10
SY0AAD18YA16FM1 hypothetical protein BC1G_08075 [Botryotinia fuckeliana B05.10]8e-14


Manual Annotation:

Please find below the necessary files for GSTUMT00007520001 annotation :

link to GSTUMT00007520001 Artemis file
link to scaffold_36 sequence file
link to scaffold_36ESTs