Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007485001
Length(AA) : 896
Localization : scaffold_36
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001213855.1| Score: 1509 E_value: 1e-165
KEGG Definition: TFIIF-interacting CTD phosphatases, including NLI-interacting factor
Accession: aor:AO090003000695 Score: 1499 E_value: 1e-164
KOG Definition: TFIIF-interacting CTD phosphatases
Classification: [
Kog Number: KOG0323 Score: 834 E_value: 2e-89
PFAM Definition: NIF, NLI interacting factor-like phosphatase. This family contains a number of NLI interacting factor isoforms and also an N-terminal regions of RNA polymerase II CTC phosphatase and FCP1 serine phosphatase. This region has been identified as the minimal phosphatase domain..
Pfam Number: pfam03031 Score: 285 E_value: 8e-26
Swissprot: Q9P376|FCP1_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0004721 = Molecular function: phosphoprotein phosphatase activity
GO:0005515 = Molecular function: protein binding
GO:0006470 = Biological process: protein amino acid dephosphorylation
GO:0006461 = Biological process: protein complex assembly

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.286NO0.778NO0.191NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4320.130.344M516

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01194First60=0.00289PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007485001
MIVQLPRSVRYPVTITAFLKQPNDDIPRLEAVLLYTYITTVTEYPEFGQE
RQVEKKLSAQFHAPVEGRLNRWLVKVGTVIEGPGVDIMEIEEPCSHEVQF
AGLCSMCGQDMTLLDHGHFSNKDRATIHMVHDSMGLTVSQDEATRLEEET
KRRLLKSKKLSLVVDLDQTIIHATVDPTVGDWKNDPFCINHESVKDVQAF
KLDEDIIGGRGTWYYVKMRPGLKEFLEHISQLYELHIYTMGTRAYAMSVK
KIVDPDGRIFGERVLSRDESGSMTQKSLHRIFPVDTKMVVIIDDRGDVWK
WSDNLVKVRPYDFFVGIGDINSSFLPKRQEFLPPTPIANAPANPTVSPAD
MVIPIDQKVEKASSSATQLAALDQLVTIGEDVSAENLLNAQSKELDKALS
AQKIDRPLARKQEEQDKKDEKAANECINGENGIESTTPSEVGRAKHSVLH
DQDVELISLERHLTEVHRSFYELYEKNGSVISSRVSELKDSKKQISKRRL
SDTNPQAVPDVKVIMPRMKTQALGDVVLVFSGIIPLGVEVQNSDIAHWCR
SFGAAVADDVHSKVTHLVAARSRTAKVRRAASKYPHIKIVTPQWLYDSIS
NWRKEPEKSYLLPIHPEDRHPRPLNGADDHRLDGPILSSEDDDSDDDEMQ
SVHTEEFSTAEMPDMTGVGWMDVDEELKEWLGSDDEDTEAEDGNAFDDKN
TDSAPKKAGKRSRSSTPDEETGDPSLEDSIPGSRLSKRQKMVRSRPGSGL
RIVEGVAPSTSSYVPPSGTDTPGSSSGTLDGISEKELEQESDEPLDAGGE
DEEEEDDFDGFAQEFDRELAEMETDENDDDGEDIVGGGGAIATSAQNEHS
QSEPAPKSPQHLIDLRSPITDSFSSLVGAGGSIGEVGGGGSANSAS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3569 unnamed protein product [Aspergillus oryzae]9e-41
SY0AAA8YO20FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00007485001 annotation :

link to GSTUMT00007485001 Artemis file
link to scaffold_36 sequence file
link to scaffold_36ESTs