Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007470001
Length(AA) : 951
Localization : scaffold_36
Number of EST contigs matching the gene: 3
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_01934
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001248163.1| Score: 3162 E_value: 0.0
KEGG Definition: FGF receptor activating protein 1
Accession: aor:AO090005001276 Score: 3161 E_value: 0.0
KOG Definition: FGF receptor activating protein 1
Classification: [Signal transduction mechanisms].
Kog Number: KOG3979 Score: 307 E_value: 2e-28
PFAM Definition: No Hit Found
Swissprot: Q9HDZ2|YKPC_SCHPO
Gene Ontology:
GO:0032153 = Cellular component: cell division site
GO:0051286 = Cellular component: cell tip
GO:0005783 = Cellular component: endoplasmic reticulum
GO:0046476 = Biological process: glycosylceramide biosynthetic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.258NO0.885YES0.224NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0740.1170.821_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=341.277First60=21.5264PredHel=15
Topology=(21-43,73-95,102-124,134-153,166-183,274-296,303-325,352-371,457-479,489-508,513-530,534-556,568-590,600-622,643-660)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007470001
MPKDKDGTVLVSMSGKWVSHTHTVTAYCGFLGALIVGMSLHFHKIVQNEH
YGYPDEWFPSVSATIGDRYPERSLFQLFICLTSGPRFALVFLWYLLTARP
GAFAPKFVASIGLIRSLLCGGWVYITSTDDHDYHDIFMISYLVFTLPWTL
GCLALSPMNLTAIKYRKLFAGLFFGTLVPLIYFFIQHKVHKVAGAYTIYA
FFEWSLILFDVGFDAVTALDFEGFEFRVVDVKSVSKGKNIALSDAVLERS
KMDKKDIPQQFLTDTYSWNDVLDALADVYSGFMFWSILTSLGVTIWYFPL
WHMGISGYEVLVMTTVSPFLLGIGPVRRIVVNHPRYVYLLSLLGLLAFVS
KVPETRLFFVAAGVWFTTLAWTGSFFAERAQPGRLEAKVSAFSLGLIASS
IAKFACRSNNPIWPIMNTENGGWNKTGLVLAVLAVLRSTRKGPVGELPLS
PPNKGGSSIIPAIGLGGLLFGLHSLLSDSSTMITWVWDGYPVKGPLAVPH
GAYALVAMGAGFLIGLLREDLARTWTLYGVGCTAAAIFHRSPGWTGYYGA
LVLALYLMALVPSFIQSATKHSPGKTFGLSFLVYNLLVLAHVWVVAYAFV
PGGPLLRERTDLIMTATMLAIGVGVFATTSYGPKSARELRAEDFPSRRRF
RSYAVYSLVGLELFAASIAYMRFPSFDYQPYHKEEKVLTAGIWTVHFALD
NDMWSSERRIRDVIKDLEVDVIGLLESDLQRIIMGNRDMTQFLAEDLGMY
ADFGPGPNKHTWGAALLSKFPIVNSTHHLLPSPVGELAPAILATLDMYGE
MVDVLVFHSGQEEDVLDRKLQSEGIAKLMGDSPRPLILLSYLVTKPKQGN
YNTYVSETSRMRDIDSSDWDRWCEYILYRGLKRIGYARVSRSTITDTEIQ
LGKFVVGEPEGTDEIIPESEVPGGYRFPDMFKGQGVRGHKYHVFNEPRYY
R

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1196 hypothetical protein CIMG_01934 [Coccidioides immitis RS]1e-101
SY0AAB14YA23FM1 integral plasma membrane protein, putative [Neosartorya fischeri NRRL 181]3e-62
SY0AAB29YE18FM1 hypothetical protein AN5011.2 [Aspergillus nidulans FGSC A4]1e-110


Manual Annotation:

Please find below the necessary files for GSTUMT00007470001 annotation :

link to GSTUMT00007470001 Artemis file
link to scaffold_36 sequence file
link to scaffold_36ESTs