Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007453001
Length(AA) : 382
Localization : scaffold_36
Number of EST contigs matching the gene: 1
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_01719
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001247948.1| Score: 1205 E_value: 1e-130
KEGG Definition: proteasome regulatory particle subunit (RpnI), putative; K03039 26S proteasome regulatory subunit N9
Accession: afm:AFUA_6G12770 Score: 1182 E_value: 1e-128
KOG Definition: 26S proteasome regulatory complex
Classification: [
Kog Number: KOG2908 Score: 1050 E_value: 1e-115
PFAM Definition: PCI, PCI domain. This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15)..
Pfam Number: pfam01399 Score: 138 E_value: 3e-09
Swissprot: Q9US13|RPN9_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0005515 = Molecular function: protein binding
GO:0043161 = Biological process: proteasomal ubiquitin-dependent protein catabolic process
GO:0051726 = Biological process: regulation of cell cycle

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.030NO0.085NO0.029NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0510.1220.929_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01874First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007453001
MDLDPKPIPEFLAQQRDEVAPPNLQSLFLEFEDFWERRLWHQLTEALLKF
YENPESTPQRIPIYKHFVLSFSDKINQLKFVTLGLSAARESKDNDEALEF
LTTIAAKVNKPTSKDAYVYATVEVARVKLLLADMEGARKALDEAEKNLET
FDSVESVVHASFYRVNADYYNAKLEFAAYYKNALLYLACVNVADLSQMEQ
QERAYNLAIAALLGESIYNFGELLLHPILDSLKGTEHSWLRDLLFAFNAG
NLTRFHGLSGHFSKQPLLEGRSSFLREKLCLSALTEAVFRRPPHDRALSF
ATILDETRVFPEEVEHLLMRALSLGLVRGSIDQVAEVARISWVQPKVLDK
EQIENMKQRLMEWDGSVNKLGNWMESRLVAGA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1039 hypothetical protein CIMG_01719 [Coccidioides immitis RS]2e-61


Manual Annotation:

Please find below the necessary files for GSTUMT00007453001 annotation :

link to GSTUMT00007453001 Artemis file
link to scaffold_36 sequence file
link to scaffold_36ESTs