Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007452001
Length(AA) : 367
Localization : scaffold_36
Number of EST contigs matching the gene: 1
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: NADH-ubiquinone oxidoreductase 39 kDa subunit, putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001258421.1| Score: 1265 E_value: 1e-137
KEGG Definition: NADH-ubiquinone oxidoreductase 39 kDa subunit, putative [EC:1.6.5.3 1.6.99.3]; K03953 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9
Accession: afm:AFUA_6G12790 Score: 1258 E_value: 1e-137
KOG Definition: NADH:ubiquinone oxidoreductase
Classification: [
Kog Number: KOG2865 Score: 690 E_value: 3e-73
PFAM Definition: Epimerase, NAD dependent epimerase/dehydratase family. This family of proteins utilise NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions..
Pfam Number: pfam01370 Score: 177 E_value: 9e-14
Swissprot: P25284|NDUA9_NEUCR
Gene Ontology:
GO:0005759 = Cellular component: mitochondrial matrix

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.402NO0.656NO0.304NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6460.0680.226M379

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.43968First60=0.41928PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007452001
MRTQLFRVAPPMRRAIHDIAITRTGKPIIRTPGGGRSSIGGHTATVFGAT
GFLGRYIVNRLARSGCTVVIPYREEMAKRHLKVTGDLGRVVFMEWDMRNT
PSIEASVRHSDIVFNLVGRDYTTKNFTYEDVHVEATQRIAEAIAKYDVDR
FIQVSSFNADKNSPSKYYATKGQAEEDARAIFPETTIVRPGPMYGFEDRL
LHRLAGTTNIFTANNMQQKMRPVHVIDVGKALEVIAYDDATASQTFELYG
PRELTLKEIAHMVDKIVHKTHRHINLPKKAFQMIASVLDYLWWPTISPDE
IERQHLDHKIDATAKTFGDLGIEPTDIEADMFQYIRHYRSAAYFDLPPMT
EKEKRLERQYLHVQQDL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1268 NADH-ubiquinone oxidoreductase 39 kDa subunit, putative [Neosartorya fischeri NRRL 181]1e-137


Manual Annotation:

Please find below the necessary files for GSTUMT00007452001 annotation :

link to GSTUMT00007452001 Artemis file
link to scaffold_36 sequence file
link to scaffold_36ESTs