Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007445001
Length(AA) : 524
Localization : scaffold_36
Number of EST contigs matching the gene: 5
Number of ESTs : 33
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_14553
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001804735.1| Score: 1096 E_value: 1e-117
KEGG Definition: ubiquitin C-terminal hydrolase Ubp8, putative [EC:3.1.2.15]; K01072 ubiquitin thiolesterase
Accession: afm:AFUA_6G12710 Score: 933 E_value: 7e-99
KOG Definition: Ubiquitin-specific protease
Classification: [Posttranslational modification
Kog Number: KOG1867 Score: 838 E_value: 3e-90
PFAM Definition: UCH, Ubiquitin carboxyl-terminal hydrolase..
Pfam Number: pfam00443 Score: 666 E_value: 3e-70
Swissprot: Q5DU02|UBP22_MOUSE
Gene Ontology:
GO:0004843 = Molecular function: ubiquitin-specific protease activity
GO:0016579 = Biological process: protein deubiquitination
GO:0006511 = Biological process: ubiquitin-dependent protein catabolic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.145NO0.256NO0.107NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.7760.0370.279M374

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.72903First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007445001
MGSTTILNRPQAASALSASPKVVKNNKSLASSSAAPLTYGCNHIEKPLQG
PTEGNKMRVLYGSATRVALDSSRAHAQTCEKCKFLITRTFLCMQCPSIYC
PKDAEAHYKEKNHRFGIDSRSGHVYCFPCQDFIYDPALEKIRVEKEVAME
GGARKRRRLDDIKPSPEDLKYIESNTTLAPCRATGLRGFLNMGSTCFMSV
VLQSLIHNPLVRNFYLADGHKPKECAQANCMSCAMEEVFSEFFATDKTDG
FGPVNLLTTSWKCEQTLAGYQQQDAHEYLQFLLNQLHATNGGNTDTKTEQ
CKCIIHRAFYGNLQSDVTCEGCQNVTTAVDPVMDLSLDLRKKDKRKLATP
KTEGDGAMQTLQECLERFTSTEKLGMNEYNCENCSGHQEVATKQLTVKRL
PPVLCIQLKRFEHGSTKSSKIDTKIRFPMQLDMAPYTTRAKRKAKDGSTD
CGPKSSLKGHGPYLYDLLSVVVHTGQINSGHYINFSRENGQWFRFDDSVV
TLATEKDVLSAKAYLLFYIIRSLT

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig372 hypothetical protein SNOG_14553 [Phaeosphaeria nodorum SN15]4e-11
Contig831 hypothetical protein CIMG_01704 [Coccidioides immitis RS]2e-35
Contig6501 hypothetical protein SNOG_14553 [Phaeosphaeria nodorum SN15]1e-117
SY0AAA31YI06FM1 hypothetical protein UM00903.1 [Ustilago maydis 521]3e-20
SY0AAB10YF21FM1 hypothetical protein SNOG_14553 [Phaeosphaeria nodorum SN15]9e-14


Manual Annotation:

Please find below the necessary files for GSTUMT00007445001 annotation :

link to GSTUMT00007445001 Artemis file
link to scaffold_36 sequence file
link to scaffold_36ESTs