Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007443001
Length(AA) : 585
Localization : scaffold_36
Number of EST contigs matching the gene: 5
Number of ESTs : 120
  User annotation : No user annotation

Blast Results:

Nr Definition: integral membrane protein
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001268327.1| Score: 1109 E_value: 1e-119
KEGG Definition: integral membrane protein
Accession: afm:AFUA_6G12730 Score: 1077 E_value: 1e-115
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: P25639|YCV1_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0008361 = Biological process: regulation of cell size

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.865YES0.995YES0.746YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0580.9180.04S123

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=224.072First60=16.3487PredHel=10
Topology=(5-24,63-85,92-114,129-146,269-291,301-323,442-459,474-496,509-526,541-563)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007443001
MLNRAVLFWLAGLTVSSLQLVSAGEEHHHHHGSHERHSDHSAPPAPGPLD
TLPYYFAHPDHKGLLYGHVALMSVGWIVVLPIAVVLAIAGSRYHLPTQLL
FLIIHGSGLFLSILYNSATPDLYPNNSHHKLGWAIVWILATQSILGVLGR
TIRFALCAGNLGGTREETSGFIPVPAQDPEDHHHHRTFQRHSTDSGQGSD
EYRSRSPSTSSLENRRYGNFEGVDLPLAEGRANGKVTLVERLTSTSWLES
FLSRHLPYLLGLRVLRISDALYSLIARFLVVLGFVQISLGIVTASGIFME
SRVFNGLAHFIKGGIFFLYGVLTLGRWLGAFSELGWAWNVKPPQDYGGKW
RSRIPSAEMIECTVIFTYGASNVFLEHLAGRGGAWSHGDLEHVSIAFMFF
GAGLCGMLVESQWIRNVLNQSIITQIGEIRGPYKPGAPRQPNTTDHKMSL
NPLPALVIFCLGVMMSQHHQSSALSTKIHAQWGALLATFGVFRLFTYVLL
YLSPLTSYYPSRPPTETIGSFCLMAGGLVFMASNKDTVAALERANGDAMF
VLTVIIGSTVLIMSWITCVMAIKGWALRKEQQQRA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig132 integral membrane protein [Aspergillus clavatus NRRL 1]1e-119
Contig738 hypothetical protein SNOG_12040 [Phaeosphaeria nodorum SN15]1e-66
Contig1154 hypothetical protein [Yarrowia lipolytica]2e-42
Contig2380 hypothetical protein NCU02378 [Neurospora crassa OR74A]1e-21
SY0AAA2YL20FM1 hypothetical protein CHGG_00404 [Chaetomium globosum CBS 148.51]5e-25


Manual Annotation:

Please find below the necessary files for GSTUMT00007443001 annotation :

link to GSTUMT00007443001 Artemis file
link to scaffold_36 sequence file
link to scaffold_36ESTs