Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007437001
Length(AA) : 414
Localization : scaffold_36
Number of EST contigs matching the gene: 2
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein PGUG_01954
Specie: [Pichia guilliermondii ATCC 6260]
Accession: ref|XP_001486283.1| Score: 169 E_value: 4e-10
KEGG Definition: hypothetical protein
Accession: dha:DEHA0A11583g Score: 160 E_value: 2e-09
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.112NO0.112NO0.069NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1710.0710.844_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.4855First60=0.00088PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007437001
MYSRRHPNKRGKPPEDTIITQYKNFIRNSQRDENGNRFVEAIVTMPPSND
WTRINRRRKTLQPRPPEIVDGDSRTTGAPSLHVLARRTLNKHIEEFTAEI
LRGIPWVIIKPIWEDALNTSRDSFLVWSRFASVYGDEPDFACHSRAQSSG
PVMERLRIEKLAYTVSLGSLIGPISNNQGMWIVYLNLLYNKGYTREELLC
IPEIPNLVVLNFPFASNGQVSTLDDGVIRSWSRSSSRDGKLSRLKVLILR
NHAGISNESPKYLSWIKSLEIVELTDTNITSDAPYWGMHWEHDKSRLWED
LATTRGVMHVFRKHQAESEKLTLLLQIGDSVTRSSEEHRDNIFILKRIRN
LAVAQAKRKGCSASSPPSGPPSSSSGQAKKRKGVRDSKKKDMGGLLAEFG
YGPSGGGFVSALGE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1700 hypothetical protein ACLA_027910 [Aspergillus clavatus NRRL 1]7e-10
SY0AAC20YK12RM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00007437001 annotation :

link to GSTUMT00007437001 Artemis file
link to scaffold_36 sequence file
link to scaffold_36ESTs