Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007410001
Length(AA) : 485
Localization : scaffold_36
Number of EST contigs matching the gene: 2
Number of ESTs : 11
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_12988
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001585896.1| Score: 1156 E_value: 1e-124
KEGG Definition: hypothetical protein
Accession: fgr:FG07263.1 Score: 1086 E_value: 1e-116
KOG Definition: NADH-dehydrogenase (ubiquinone)
Classification: [Energy production and conversion].
Kog Number: KOG2495 Score: 932 E_value: 1e-101
PFAM Definition: Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain..
Pfam Number: pfam07992 Score: 362 E_value: 5e-35
Swissprot: P40215|NDH1_YEAST
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion
GO:0003954 = Molecular function: NADH dehydrogenase activity
GO:0005515 = Molecular function: protein binding
GO:0001300 = Biological process: chronological cell aging
GO:0019655 = Biological process: glucose catabolic process to ethanol
GO:0006116 = Biological process: NADH oxidation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.192NO0.524NO0.128NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.7470.0180.379M431

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.96154First60=0.58724PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007410001
MATILRRETCVRGVSRRAAVCGGSIIQRRTFSLQELDEKRGTRERVVILG
SGWGGFGLARQLDLRHYQPLIITPRTYFVFTPLLASTAVGTLEFRQAMEH
SRSRPGIEVIRAWAEQIDLSKKTVTVEGAVQSKDKVGSVIGDGKQFEVGW
DKAVVAVGAFSQTFGVEGVKDHAFFLKDVADARAIRRRILECFEEAALPT
ASEARKKQLLHFAVVGGGPTGIEFSAELHDLLSDDLTKLYPSLAKYHRIT
VYDVAPRILSMFDTSLAKYAEKVFSRQKISIKTSHHVHKVNSEAVHTRED
GEVLVGCVVWSTGLAPNPFLAKALKGKLQMDERGSKIVVDDHLRASSMDE
RGSTSWPLDDVFAIGDCASLGGQELPATAQVANQQAIWLGKTLNKAAVRK
AAEGKPGPVKVQDEKKFRFRSLGIMAYLGGWRAITQSGSAELKGRMAWVL
WRTAYLTKSVSWRNRILIPTLWFTNWVMGRDINRF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig381 hypothetical protein SS1G_12988 [Sclerotinia sclerotiorum 1980]5e-68
SY0AAA33YB10FM1 hypothetical protein FG07263.1 [Gibberella zeae PH-1]3e-35


Manual Annotation:

Please find below the necessary files for GSTUMT00007410001 annotation :

link to GSTUMT00007410001 Artemis file
link to scaffold_36 sequence file
link to scaffold_36ESTs