Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007385001
Length(AA) : 711
Localization : scaffold_35
Number of EST contigs matching the gene: 1
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_01283
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001791929.1| Score: 1174 E_value: 1e-126
KEGG Definition: hypothetical protein
Accession: ncr:NCU08517.1 Score: 945 E_value: 1e-100
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.145NO0.420NO0.132NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3060.2180.282M5119

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.10211First60=0.00023PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007385001
MPISVSPSPSPPLQLCLPAAAVPQHNVRAIRAPPREWPPIRYQTELSATE
AKKFIGDGAPKFCGELREITNGPRGYYYLFAFAGDEWDEESDTALFQSDS
FCDMSSSPEGRQTDALERPAMAHAFGIYPGTITLSCYVTSFGSTLQGHEV
AARGKVRKLTMLYVLDRLRILQVKGIEEDLGQLHMHLYDYLLHDTHRYDS
KNHVSLDNQISDLVAALCRPSWVNFSSSENQTIARFLSDPNPGVANSFFH
QLLLSIELYLRINARHQTNLAAKPLPDMPEKIRWDLMLAQRWLENVEVEA
PKKVKDGKGKREQKSSVGFKFPHKKTQVEALRNFAWTLKWPNMHEVEYTL
SEGEDPNEVLEDRSINCMSWFTGLLLPGKSMPWILMNALTDCDPDVPETF
HNLSQTTPNVGFQYRGHTYWSWECIVGKVLGAAAGVAQIAGWIGPCSASA
DLSRSEMAIINQMPPRGNKITPSNVRGMALNSDPLGACQTTYPVDDYVLL
TPSTDDPVEDIRIERLNFSPAASSPKKGVPRITENGHQAAEESPVLTFDA
SITFAITVERRTRSWKVSLRHNTPFIAAYPCQNGPHVLFCEYQHRVIYAD
KLVEIQNWGPSGGVEDSEVDDEGGQPENTSTGVEEVLVVEAFGVPDNEVF
VRAWCSFWGLPAITADVNKTCMACAIREAYAALVSVVILTNKSSISVEVE
EVDRLMENLQV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1157 hypothetical protein SNOG_01283 [Phaeosphaeria nodorum SN15]1e-119


Manual Annotation:

Please find below the necessary files for GSTUMT00007385001 annotation :

link to GSTUMT00007385001 Artemis file
link to scaffold_35 sequence file
link to scaffold_35ESTs