Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007366001
Length(AA) : 514
Localization : scaffold_35
Number of EST contigs matching the gene: 2
Number of ESTs : 10
  User annotation : TmelPkaR  [+]

Blast Results:

Nr Definition: hypothetical protein SNOG_01493
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001792131.1| Score: 1134 E_value: 1e-122
KEGG Definition: CAMP-DEPENDENT PROTEIN KINASE REGULATORY CHAIN
Accession: ncr:NCU01166.1 Score: 1012 E_value: 1e-108
KOG Definition: cAMP-dependent protein kinase types I and II
Classification: [
Kog Number: KOG1113 Score: 799 E_value: 1e-85
PFAM Definition: cNMP_binding, Cyclic nucleotide-binding domain..
Pfam Number: pfam00027 Score: 217 E_value: 3e-18
Swissprot: Q01386|KAPR_NEUCR

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.032NO0.083NO0.049NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0490.0710.95_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01173First60=0.0003PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007366001
MSLPEAYLDEVNALNREILKSKPTDVLQFCANFFNRRLEAQRVEFLLSAS
NNSGFSSSNTFGAMPSSSAYGGGESLFPGSVVNLGGPPLDGNRESPFSGT
IREEDEDVGQSPTTPSFRPAVLGGPSISNPSLAAPPLSPGQSLFSPRSRF
AFGNDQPPHPGSSHLSPSIHLSPNSASLDFPSNYNMGRRTSVSAESLVPS
SSNEEWNPPVYPKTPEQLGRLKTAVSGNFLFMHLDDDQSGQVLSALMEKP
IPGKGTRVITQGDVGDFFYVVEKGSFDVYVNSAGSMLPGLDGMGKKVNSI
GPGGSFGELALMYNAPRAATIISTTSQNILWALDRVTFRRILMENTFKRR
RMYEAFLEEVSILSSLVPYERAKIADALEPFTFHPGDVIIQQGDPGDNFY
IIESGEAEVVKHGAHEPVNRLTKGDYFGELALLNDAPRAASVRAVTRVKV
ATLGKDGFQRLLGPVAEIMRRNDPRLAEGVDPLSNVGSPGPSGGFDGGKD
VVEEAAGRGRAVEV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig6302 hypothetical protein SS1G_10536 [Sclerotinia sclerotiorum 1980]1e-108
SY0AAB52YJ11FM1 hypothetical protein SNOG_01493 [Phaeosphaeria nodorum SN15]7e-14


Manual Annotation:

Please find below the necessary files for GSTUMT00007366001 annotation :

link to GSTUMT00007366001 Artemis file
link to scaffold_35 sequence file
link to scaffold_35ESTs