Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007300001
Length(AA) : 650
Localization : scaffold_34
Number of EST contigs matching the gene: 3
Number of ESTs : 41
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_07940
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001240777.1| Score: 665 E_value: 2e-67
KEGG Definition: hypothetical protein
Accession: ani:AN1844.2 Score: 634 E_value: 4e-64
KOG Definition: Thioredoxin binding protein TBP-2/VDUP1
Classification: [General function prediction only].
Kog Number: KOG3780 Score: 136 E_value: 1e-08
PFAM Definition: Arrestin_N, Arrestin (or S-antigen), N-terminal domain. Ig-like beta-sandwich fold. Scop reports duplication with C-terminal domain..
Pfam Number: pfam00339 Score: 159 E_value: 2e-11
Swissprot: P78612|PALF_EMENI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.145NO0.467NO0.128NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.7230.0270.379M417

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00128First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007300001
MVTDSPPPRTGLLTRLRSKTSSLSLPGLRAPRRRILADFHIQLDDPHRVY
LANDVVKGCVCVKVERPLTLTHLVVNLIGRVDLQASLYTREGGGKKGKEW
EEEFDGLSGGVTVCRDEIVLCGEGRLEPGVYKFGFELEFALVGKLPGGLP
SSLDFEKGSISYRISSTLTRPTTISPTTTCTTKLSFVETIDIAHLSAPKP
RVISLEPIVSKKPRNKQRPSSPIPGTGRDQSTTPSPNNSNGNLPNVEPRA
PSPTPSTDPSRMIRSKTITASITLMKAGALRGDNIPVKISIHHNKPIKSL
NGIILTLHRQTRFDPPSRSHPPLKKALSSAATGGTCGGTFRKDLAQTVLP
LMIDPKSLTTVVRANLRVPEDVFPTIVNVPGGGVSFRYYVEVVVDLGGKL
SSRDDFFKGGASILGLPRPGTGGEKDAGGANAGIAVEGGVMVETERIRRE
KRIVFCRFEVIIGSIDSVGGKGRRGGVSAKSLTRSQTVEEEEGSEANDTA
PSTPRRPSHSHMEGSEAPDQMEDEAPEYFRHERIDGSLLLPLPPVETRPE
NPMDEKTHLILAEEQLLPSAPPMDPSSPACYIHPSAPSPSGDDNRQLAEG
DKLGMERQRLLQAASAPPEESVESSDTTISAPSAPILEDECYEGPPRYVR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3219 hypothetical protein CIMG_07940 [Coccidioides immitis RS]5e-67
SY0AAA47YE17FM1 No hit found
SY0AAB14YF04FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00007300001 annotation :

link to GSTUMT00007300001 Artemis file
link to scaffold_34 sequence file
link to scaffold_34ESTs