Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007296001
Length(AA) : 349
Localization : scaffold_34
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: putative oxidoreductase
Specie: [Fusarium oxysporum f. sp. lycopersici]
Accession: emb|CAJ85791.1| Score: 596 E_value: 1e-59
KEGG Definition: hypothetical protein
Accession: fgr:FG03740.1 Score: 587 E_value: 5e-59
KOG Definition: Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family)
Classification: [General function prediction only].
Kog Number: KOG1238 Score: 504 E_value: 1e-51
PFAM Definition: GMC_oxred_C, GMC oxidoreductase. This domain found associated with pfam00732..
Pfam Number: pfam05199 Score: 321 E_value: 2e-30
Swissprot: A8AJN0|BETA_CITK8
Gene Ontology:
GO:0008812 = Molecular function: choline dehydrogenase activity
GO:0019285 = Biological process: glycine betaine biosynthetic process from choline

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.033NO0.071NO0.030NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1220.1310.833_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=4.69578First60=0.46684PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007296001
MKYVQPGDATKYIAKAKKEVIISAGTLHTPQILQLSGIGQKSLLEKLGIP
VLIDLPGVPSAQRTEPPGSPIAVGTMSLKLDNVEHSVIDLEKNATWDAES
KDLFYKAREGPWTAGSPNSVAFLPLSTYTNQSETLLGAYTTQAPGQYLRN
DYDPVITASFQKHRQILLNRLAGTHTAAMEYMWLSGANRFFQMPFSISIT
HPFSRGFIEINSTDPLAAPIVDLRTGSNPVDLNLFIEAFRFCRRVVQTRA
IQELVPTELTPGPSLQTDEELRRFTRDSLSTMFHPSGTSAMQPREIGGVV
DHNLIVYGTENLRVVDASIIPLIPGTHIVSTVYAIGEKAADIIKAACKE

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB21YO22FM1 hypothetical protein BC1G_03220 [Botryotinia fuckeliana B05.10]2e-22


Manual Annotation:

Please find below the necessary files for GSTUMT00007296001 annotation :

link to GSTUMT00007296001 Artemis file
link to scaffold_34 sequence file
link to scaffold_34ESTs