Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007244001
Length(AA) : 594
Localization : scaffold_33
Number of EST contigs matching the gene: 1
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE54877.1| Score: 1989 E_value: 0.0
KEGG Definition: dihydroxy-acid dehydratase [EC:4.2.1.9]; K01687 dihydroxy-acid dehydratase
Accession: aor:AO090009000414 Score: 1989 E_value: 0.0
KOG Definition: Dihydroxy-acid dehydratase
Classification: [Amino acid transport and metabolism].
Kog Number: KOG2448 Score: 1867 E_value: 0.0
PFAM Definition: ILVD_EDD, Dehydratase family..
Pfam Number: pfam00920 Score: 1581 E_value: 1e-176
Swissprot: Q10318|ILV3_SCHPO
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.025NO0.060NO0.023NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1420.0550.875_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.28337First60=0.0077PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007244001
MAEDSSQPQQQGNGKSHFLEFRSIPYGTKRDGELVLNRHSSILTNGYEFP
GAQAMLYAAGIKSQEDMRKKPHVGVASVWWEGNPCKYVLDLGKTVKEGLE
KIGMIGWQFNTIGVYAARPLLLVLREFSLQSRDIIADSIETTTCAQHHDA
NISIPGCDKNMPGCIMAMARHNRPSIMIYGGSIKGGYSERLRQPVNISSC
FEAHGALMYGKVSEADLDDVVRHACPGPGGCGGMYTANTMATAIEAMGLT
LPGSSTTPAESPAKMRECLRVSEAIRICLERDIKPRDLITRESFENAMVV
TIIMGGSTNAVLHFLAISHTTDLDLTIDDFQRVSDKIPYLADLKPSGKYM
VADLAEIGGMPSVLKFLIHASLVNGDIPTVTGKTLRENCEPAPSLDPGQD
IIRPLSNPIKSSGHIRILKGNLAPGGAVAKITGKEGKVFVGKARVYDGEP
ALISSLEKGEIKPGENTVLCVRYEGPKGGPGMPEQLKTSAVLMGAGLRNV
ALITDGRYSGVITLKVGHIVPEAQVGGPIAILKDGDIVAINAETNQISMN
VSDGEIASRLKSWKAPRLKVTRGTLAKYAHLVGDASHGAVLDMF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1013 hypothetical protein SS1G_08872 [Sclerotinia sclerotiorum 1980]0.0


Manual Annotation:

Please find below the necessary files for GSTUMT00007244001 annotation :

link to GSTUMT00007244001 Artemis file
link to scaffold_33 sequence file
link to scaffold_33ESTs