Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007236001
Length(AA) : 212
Localization : scaffold_33
Number of EST contigs matching the gene: 3
Number of ESTs : 25
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_09800
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001800087.1| Score: 434 E_value: 2e-41
KEGG Definition: hypothetical protein
Accession: ncr:NCU07834.1 Score: 420 E_value: 5e-40
KOG Definition: Transcription factor
Classification: [
Kog Number: KOG0049 Score: 121 E_value: 1e-07
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.239NO0.319NO0.141NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1350.0790.848_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00317First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007236001
MAHQRPPPHMGGAGGSGHLYEIDLSDDQDVDSHYQHQHLPPPSHHHQHPQ
HTHHHHMPDQPPPAKMARTTSVMGVGGGSQMGGSSMGMPGPSSLAGPSSS
QQMPAPAPRPRGPKLKFTPEDDQLLVDLKENKALTWKQIAEFFPGRSSGT
LQVRYCTKLKAKTTQWTDETVLRLRNAIQEYDQDRWRLIAAKVGNGFSPA
ACREKAKELQEP

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1476 hypothetical protein SNOG_09800 [Phaeosphaeria nodorum SN15]1e-40
Contig2810 hypothetical protein BC1G_06752 [Botryotinia fuckeliana B05.10]2e-23
Contig2913 hypothetical protein SNOG_09800 [Phaeosphaeria nodorum SN15]2e-14


Manual Annotation:

Please find below the necessary files for GSTUMT00007236001 annotation :

link to GSTUMT00007236001 Artemis file
link to scaffold_33 sequence file
link to scaffold_33ESTs