Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007225001
Length(AA) : 284
Localization : scaffold_33
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: Ankyrin repeat protein
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP48589.1| Score: 532 E_value: 2e-52
KEGG Definition: hypothetical protein
Accession: ang:An02g10560 Score: 466 E_value: 4e-45
KOG Definition: Ankyrin
Classification: [Cell wall/membrane/envelope biogenesis].
Kog Number: KOG4177 Score: 317 E_value: 4e-30
PFAM Definition: No Hit Found
Swissprot: Q02357|ANK1_MOUSE
Gene Ontology:
GO:0005515 = Molecular function: protein binding
GO:0048821 = Biological process: erythrocyte development
GO:0015672 = Biological process: monovalent inorganic cation transport

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.064NO0.190NO0.060NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.540.0310.542_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00474First60=0.00013PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007225001
MSQPFNNNISSFSGPHRTPLWYAAQNGHGEVVEMLLGRQDIIPDKEDEGG
QTPLSCAAEGGHEGVVNMLLGRDDVNPNRLDDGGKTPLHHAAWSCREGVV
KILLRRGDVNPNVQDDSGNTLLHVATWGGYGGVVKALLGRDDISPDKPDN
NGQTPLWCAARSGYVGVVKTLLGWGDINPNAPDDDGQTPLHTAAWNGHEE
VVKVLLWRNDVDPNKLGGDGQTPLGWAARHGDGGVVKALLARGDTNPDKP
DHLGRTPLWWAAEHRHAGVMTLLQCPTSATRSTG

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA34YE08FM1 unnamed protein product [Aspergillus oryzae]1e-32
SY0AAB24YD23FM1 ankyrin repeat domain protein [Neosartorya fischeri NRRL 181]3e-32


Manual Annotation:

Please find below the necessary files for GSTUMT00007225001 annotation :

link to GSTUMT00007225001 Artemis file
link to scaffold_33 sequence file
link to scaffold_33ESTs