Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007224001
Length(AA) : 216
Localization : scaffold_33
Number of EST contigs matching the gene: 1
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001212453.1| Score: 445 E_value: 1e-42
KEGG Definition: ankyrin repeat
Accession: aor:AO090010000141 Score: 433 E_value: 2e-41
KOG Definition: 26S proteasome regulatory complex
Classification: [
Kog Number: KOG4412 Score: 290 E_value: 3e-27
PFAM Definition: No Hit Found
Swissprot: Q02357|ANK1_MOUSE
Gene Ontology:
GO:0005515 = Molecular function: protein binding
GO:0048821 = Biological process: erythrocyte development
GO:0015672 = Biological process: monovalent inorganic cation transport

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.180NO0.402NO0.203NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.7080.030.365M489

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00435First60=0.00026PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007224001
MAPSFTGNISVFNRSRGTPLWYAAMNGHEEVVKMLLERQDVIPDKADERG
QTPLFRAAAGGHVEVVRTLLGRDDVNPNTLDKSGQTPLHYATWNRREGVV
KMLLGRSDVNPNVTDDTGLTPLHDSAEGGHEEVVNLLLGRQDVNPDKPDI
DGQTPLWCAARNGHEGVVKILLGRADVDSSKPDNYGHTPLWWATTNGHAG
VVALLQSQPSASCSTA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1513 conserved hypothetical protein [Aspergillus terreus NIH2624]2e-42


Manual Annotation:

Please find below the necessary files for GSTUMT00007224001 annotation :

link to GSTUMT00007224001 Artemis file
link to scaffold_33 sequence file
link to scaffold_33ESTs