Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007140001
Length(AA) : 246
Localization : scaffold_32
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: Ankyrin repeat protein
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001259703.1| Score: 255 E_value: 2e-20
KEGG Definition: ankyrin repeat
Accession: aor:AO090001000528 Score: 245 E_value: 1e-19
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.045NO0.152NO0.046NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0850.060.92_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.02966First60=0.00625PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007140001
MRHQDIQALRAENVGDWLFETGEFRRWRETSGEANCENAAMFCYGDPGVG
KIYLSSLVIDRLGDEARGRSDIVACFYFDFAARNEQIPVNVLGSLLKQMV
GGLGTIPEDIVQAFEDQKKIIGGRRLRVPEIVKMLQTVIFSQCIFICVDA
LDECAEKHRSEVLDSLREILDKSKCTRIFITGRRHICGEMERQLAGKAVM
VPIKPNNEDLRGYIRMRLSRDTIRDAMDTGLEAEITKSLAENIPES

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB40YO11FM1 unnamed protein product [Aspergillus oryzae]2e-08


Manual Annotation:

Please find below the necessary files for GSTUMT00007140001 annotation :

link to GSTUMT00007140001 Artemis file
link to scaffold_32 sequence file
link to scaffold_32ESTs