Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00007133001
Length(AA) : 255
Localization : scaffold_32
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_07910
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001591284.1| Score: 429 E_value: 1e-40
KEGG Definition: hypothetical protein
Accession: afm:AFUA_1G06500 Score: 398 E_value: 3e-37
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.981YES0.994YES0.633YESN

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0210.9950.009S124

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=88.2501First60=42.7203PredHel=4
Topology=(7-29,39-61,133-155,198-220)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00007133001
MRPLLSRIIPLLLLSIVILSILFATVYLPQVALLTLFHGPLAWINAAFMA
LTEAATLITFVAENFMTEGQIVDTFDAVLIHAAEKSNDAEFRERIYALVH
TARDIHLEREGVIAKLGEHRKSPYLRFSCRLTMEFICELPLNFIPLVGTP
LFLMLQGYHLGPLSHYRYIQLNDLHKKEKKKFIDLNRWRYWLFGLPHVGL
QVVPVLSILFLFTSAAGAGLWAVEDQKRLFDGTARSGPSEYPSGRESERK
KSWWW

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB8YC13FM1 hypothetical protein SS1G_07910 [Sclerotinia sclerotiorum 1980]1e-34


Manual Annotation:

Please find below the necessary files for GSTUMT00007133001 annotation :

link to GSTUMT00007133001 Artemis file
link to scaffold_32 sequence file
link to scaffold_32ESTs